(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5175

AL939122.SCO5175     Location/Qualifiers
FT   CDS_pept        253391..254458
FT                   /transl_table=11
FT                   /gene="SCO5175"
FT                   /gene_synonym="SCP8.38"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.38, possible integral membrane protein, len:
FT                   355 aa; similar to TR:Q9RWF6 (EMBL:AE001927) Deinococcus
FT                   radiodurans hypothetical 51.5 kD protein DR0712, 494 aa;
FT                   fasta scores: opt: 182 z-score: 183.8 E(): 0.009; 30.3%
FT                   identity in 429 aa overlap"
FT                   /db_xref="GOA:Q9FBI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI4"
FT                   /protein_id="CAC01376.1"
FT                   /translation="MKGLLHRHRELCERAVDPLEIVAGLEAHGVTDRTAARFRHRDVFS
FT                   LAEEMYARVPRDGDAPAPPEDGPTPRPGGPRAAGSVLLALLPGVLCAAAVAGLRLTDGR
FT                   PRLIAAAVGVLAVSLALGAALRRGPLTAATRTTSTWTCWLLGYALLGDGLLRTAVSGGP
FT                   DGLPDGSPDGAWPVTLAPVLALTLSYAPAAGCAHLFAAGARRKLSSSRGLTDFSASVRP
FT                   LLLGAFALYLGALAALLTLTGAVLGEPADWSQGLSLGALLLLARLLGVHGHTHAGPFVL
FT                   TATAAAEAAALATVFAGRLPGCGLLSAPVEALVAACGPAGVPTAACGIGALALLVHACR
FT                   RLTRASAHASTERTR"
     gtgaaggggc tgttgcaccg gcaccgcgaa ctgtgcgaac gcgccgtgga cccgctggag        60
     atcgtggcgg gcctggaggc gcacggagtc accgaccgga ccgccgcacg cttccgtcac       120
     cgggacgtct tctccctcgc ggaggagatg tacgcccggg tcccgcgcga cggcgacgcc       180
     cccgcacccc ccgaggacgg gccgacgccc cggccgggcg gaccccgcgc cgccgggtcc       240
     gtcctcctcg ccctgctgcc cggcgtgctg tgcgcggccg ccgtggccgg actgcgcctg       300
     accgacggcc ggccgcgcct gatcgcggcc gccgtcggag tcctcgcggt gagcctggcc       360
     ctgggcgcgg cgctgcgccg cgggccgctg accgccgcga cgcgcaccac cagcacctgg       420
     acctgctggc tcctcggcta cgccctcctc ggcgacgggc tcctgcggac cgcggtcagc       480
     ggcggccccg acggcctccc ggacggctcc cccgacgggg cgtggcccgt caccctcgcc       540
     cccgtcctgg cgctcacgct gtcctacgcg cccgcggccg gctgcgccca cctcttcgcc       600
     gcgggcgccc gccgcaagct gtcgtccagc cggggtctca ccgacttctc cgcctccgtg       660
     cgcccattgc tgctcggcgc gttcgccctg tacctgggag ccctggcggc tctgctcacg       720
     ctgaccggcg ccgtgctggg cgaacccgcc gactggtccc agggcctcag tctgggcgcc       780
     ctgttgctgc tcgcccggct gctcggcgtg cacggccaca cccacgccgg cccgttcgtc       840
     ctcaccgcca cggccgccgc ggaggcggcc gccctggcca cggtcttcgc cggccgcctc       900
     ccgggctgcg gcctcctgtc cgcccccgtg gaggcactgg tcgccgcctg cggcccggcc       960
     ggtgtcccga cggccgcctg cggcatcggc gccctcgccc tcctcgtcca cgcgtgccgt      1020
     cgcctgaccc gggcatcggc ccacgcttcg acggagcgaa cgcggtga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page