(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5176

AL939122.SCO5176     Location/Qualifiers
FT   CDS_pept        254510..255622
FT                   /transl_table=11
FT                   /gene="SCO5176"
FT                   /gene_synonym="SCP8.39"
FT                   /product="putative reductase"
FT                   /note="SCP8.39, probable reductase, len: 370 aa; similar to
FT                   TR:O54256 (EMBL:AJ224512) Streptomyces nogalater putative
FT                   dTDP-4-keto-6-deoxyhexose reductase SnoG, 328 aa; fasta
FT                   scores: opt: 316 z-score: 337.4 E(): 2.5e-11; 30.5%
FT                   identity in 364 aa overlap"
FT                   /db_xref="GOA:Q9FBI3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI3"
FT                   /protein_id="CAC01377.1"
FT                   /translation="MKEPPDDHLPTRRLGTGSRPMRVLLIGANGYIGRFVADRLLADPA
FT                   VQLTALGRGDDADVRFDLATGSPGALTRFLDAVHPGVVVNCAGATRGGARELTRHNTVA
FT                   VATVCEALRRSGCGARLVQVGCSAEYGPSQPGSSTAEDAVPRPGGPYGVSKLAATELVL
FT                   GSGLDAVVLRVFSPAGPGTPAGSPLGRLAEAMRRAMQSGDGELRLGGLGAQRDFVDVRD
FT                   VARAVHAASLSAAQGVINIGSGRAVRLRDAAATLARVAGYGGALHELDGPPGALRPTIG
FT                   HPRTESLGHRVDALGHHRSDALGHHRPDPLQSRGERTDPEHTTPAPYPDGCGSWQQADV
FT                   RTARDRLGWRPRIALEESLADIWMEAACRI"
     ttgaaggagc ccccagatga ccacctcccg acccgacgcc tcggcaccgg gagccgcccg        60
     atgagagtcc tgctgatcgg agccaacggc tacatcggcc gcttcgtcgc cgaccgtctg       120
     ctcgccgacc ccgccgtcca gctcaccgcc ctcggccgcg gtgacgacgc cgacgtccgc       180
     ttcgacctcg ccaccgggag cccgggcgcc ctcacccgct tcctggacgc ggtccatccc       240
     ggagtggtgg tcaactgcgc gggcgcgacc cggggcggcg cccgcgaact cacccggcac       300
     aacaccgtcg ccgtcgcgac cgtctgcgag gccctgcgcc gcagcggctg cggcgcccgc       360
     ctggtgcagg tcggctgcag cgcggagtac ggacccagcc agcccggttc ctcgaccgcg       420
     gaggacgccg tcccccgccc cggcggtccc tacggcgtca gcaagctcgc cgcgaccgaa       480
     ctcgtcctcg gctccggtct ggacgccgtc gtcctgcggg tcttctcgcc cgcggggccc       540
     ggtacgcccg ccggctcccc gctgggccgg ctcgccgagg ccatgcgccg cgccatgcag       600
     tccggcgacg gcgaactccg gctcggcggc ctgggcgccc agcgggactt cgtcgacgtc       660
     cgggacgtcg cgcgagcggt gcacgccgcc tcgctctccg ccgcgcaggg cgtcatcaac       720
     atcggctccg gccgcgccgt ccggctgcgc gacgccgccg ccaccctcgc cagggtcgcc       780
     ggctacggcg gggccctgca cgaactcgac gggccccccg gcgcgctgcg gcccacgatc       840
     ggccaccccc gtaccgagtc cctcggccat cgtgtcgacg ccctcggtca ccaccggagc       900
     gacgccctcg gccatcaccg tccggacccc ctccaaagcc gcggcgagcg caccgacccc       960
     gagcacacga ccccggcccc gtaccccgac ggctgcggca gctggcagca ggccgatgtg      1020
     cgcaccgcac gcgaccggct cggctggcgg ccccggatcg ccctcgaaga gtccctcgcc      1080
     gacatctgga tggaggcggc atgtcgtatc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page