(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5179

AL939122.SCO5179     Location/Qualifiers
FT   CDS_pept        complement(257673..259214)
FT                   /transl_table=11
FT                   /gene="SCO5179"
FT                   /gene_synonym="2SC3B6.03c"
FT                   /product="peptidase"
FT                   /note="2SC3B6.03c, peptidase, len: 513 aa; identical to
FT                   TR:Q54399 (EMBL:L42759) Streptomyces lividans proteinase
FT                   SlpE, 513 aa and highly similar to Streptomyces coelicolor
FT                   2SC3B6.04c, 516 aa; fasta scores: opt: 1544 z-score: 1384.8
FT                   E(): 0; 50.2% identity in 526 aa overlap. Contains Pfam
FT                   match to entry PF00561 abhydrolase, alpha/beta hydrolase
FT                   fold and correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site.
FT                   Also contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK9"
FT                   /protein_id="CAC01309.1"
FT                   /translation="MARLVRWTALTAAAALLTAGCSGGSSDEDKDDGGRSSAGPSAAAP
FT                   SGVPEALASQTLDWARCEGTDDAPAPDGDWRCATLKAPLDWSDPDGETIDLALIRSRAS
FT                   GDDRIGSLLFNFGGPGASGVSTMPSYADTVSSLHERYDLVSWDPRGVAASEGVRCRTDE
FT                   AIEAAESVDSTPDSPAEEQAYLKDAADFGRGCEKAAGKLMEHVSTTDTARDMDLMRHVL
FT                   GDERMHYFGISYGTELGGVYAHLFPEHVGRVILDAVVDPGADTMGHAENQARGFQRALD
FT                   DYLESTGQEPEQGSRKIAGLLERLDAEPLPTSSPGRELTQTLAFTGIVLPLYSESGWPA
FT                   LTSALKAAEEGDGSELLALADGYNERDPSGRYGTTTHSQRVISCLDDKQRPTVEETKKL
FT                   LPRFEKVSPVFGAFLGWDTAGWCHDWPVAGQHETAEVSAPGADPVLVVGNTGDPATPYE
FT                   GARRMADELGKDVGVVLTWQGEGHGAYGNGSDCVDSAVDAYLLKGTVPKDGKVCS"
     atggcgcgtc tcgtccggtg gacggctctg acggccgccg ccgcactgct gacggcgggc        60
     tgcagcggcg gctcgtccga cgaggacaag gacgacgggg gcaggagcag cgcgggacct       120
     tcggcggcgg caccctccgg ggtgccggag gcactggcgt cccagacgct ggactgggcc       180
     cgatgcgagg gcaccgacga tgccccggca ccggacggcg actggcggtg cgccacgctg       240
     aaggcaccgc tggactggtc cgaccccgac ggcgagacga tcgatctcgc gctgatccgg       300
     tcccgggcga gcggggacga ccgcatcggc tccctgctgt tcaacttcgg cggcccgggc       360
     gcctccggcg tctccacgat gccgtcctac gccgacaccg tctcctccct gcacgagcgg       420
     tacgacctgg tgagctggga cccgcgcggg gtggccgcca gcgagggcgt ccgctgccgc       480
     accgacgagg cgatcgaggc cgccgagtcg gtggactcca cgccggactc cccggccgag       540
     gagcaggcct acctgaagga cgccgccgac ttcggcaggg gctgcgagaa ggccgccggc       600
     aagctcatgg aacacgtctc gaccacggac acggcccgcg acatggacct gatgcggcac       660
     gtcctgggcg acgagaggat gcactacttc ggcatctcct acggcaccga actcggcggc       720
     gtctacgccc atctgttccc cgagcacgtg ggccgcgtga tcctcgacgc ggtggtggac       780
     ccgggcgccg acacgatggg ccacgccgag aaccaggcca ggggtttcca gcgcgcgctg       840
     gacgactacc tggagtcgac cggccaggaa cccgaacagg ggtcgcggaa gatcgccggc       900
     ctgctggagc ggctggacgc cgagccgctg cccacgtcct cgccggggcg ggagctgacg       960
     cagaccctcg cgttcaccgg catcgtgctg ccgctgtaca gcgagagcgg ctggccggcc      1020
     ctgaccagtg cgctgaaggc ggccgaggag ggcgacggct cggagttgct ggccctcgcc      1080
     gacggctaca acgagcgtga tccttcgggg cgctacggca cgacgaccca ctcgcaaagg      1140
     gtcatatcgt gcctggacga caagcagcgg ccgaccgtgg aggagacgaa gaagctgctg      1200
     ccgaggttcg agaaggtctc tcccgtcttc ggcgccttcc tcggctggga cacggccggg      1260
     tggtgccacg actggccggt ggccggtcag cacgagaccg cggaggtgag cgcgcccggc      1320
     gcggacccgg tcctggtggt cggcaacacg ggcgacccgg ccacgcccta cgagggcgcc      1380
     cgcaggatgg cggacgagct gggcaaggac gtcggcgtgg tgctgacctg gcagggcgag      1440
     ggacacggtg cctacgggaa cgggagcgac tgtgtcgact ccgcggtgga cgcctacctg      1500
     ttgaagggga cggtgccgaa ggacggcaag gtctgctcat ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page