(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5183

AL939122.SCO5183     Location/Qualifiers
FT   CDS_pept        264641..268120
FT                   /transl_table=11
FT                   /gene="SCO5183"
FT                   /gene_synonym="2SC3B6.07"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.07, possible ATP-dependent DNA helicase, len:
FT                   1159 aa; similar to TR:O53347 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis putative ATP-dependent DNA helicase,
FT                   MTV014.45c, 1101 aa; fasta scores: opt: 349 z-score: 368.0
FT                   E(): 5e-13; 29.2% identity in 1144 aa overlap  to
FT                   SW:UVRD_ECOLI (EMBL:M87049) Escherichia coli DNA helicase
FT                   II (EC 3.6.1.-) UvrD, 720 aa; fasta scores: opt: 241
FT                   z-score: 255.5 E(): 9.2e-07; 26.3% identity in 800 aa
FT                   overlap and to Streptomyces coelicolor 2SC3B6.08, 1222 aa;
FT                   fasta scores: opt: 406 z-score: 336.0 E(): 4.2e-13;30.4%
FT                   identity in 977 aa overlap. Contains Pfam match to entry
FT                   PF00580 UvrD-helicase, UvrD/REP helicase and match to
FT                   Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop). Also contains 5x conserved repeat unit: ADAD"
FT                   /db_xref="GOA:Q9FCK5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK5"
FT                   /protein_id="CAC01313.1"
FT                   /translation="MSSSSSSGHPSHPQVRRGSRGAYRLVRTPPARTDPPRLDAAQRAV
FT                   VDHRSGPLLVLAGPGTGKTTTLVESVADRIARGGDPERILVLTFSRKAAVELRDRMALR
FT                   IGAARAPRATTFHSFGYALVRAHQDSDLFVEPLRLLSGPEQDVTVRELLAGQVDLERLG
FT                   LAHVRWPDELRACLTTRGFADEVRAVLARSRELGLGPDALAAFARRIGRPDWRAAAVFL
FT                   AEYLDVLDLQGVLDYAELVHRAVLLARRPEVAAHLTAQYDAVYVDEYQDTDPAQVRLLH
FT                   ALADGGRTLVAFGDPDQSIYAFRGADVNGILDFPTAFPRADGRPAPVGVLRTARRSGSG
FT                   LLAATRLLTQRMPLTRLPADKVRAHRELTPVRGGGRVEAYTYPTAGTELDNIADILRRA
FT                   HLEDGVPWRDMAVLVRAGSRTIPTLRRALTSAGVPLDIDGDDLPLRHEPAVAPLLTALR
FT                   AVAEAEADTGARTGERFGALGSEADADPRADADADADADADAYVDADADAYVDEGGDAA
FT                   TKLSRGEHAYRADEPCWLSTETALTLLTSPLAGMDAADLRRLGRALRDERRAAGNPLPP
FT                   PSDELLAQALAEPERLAVHDPAYARGAQRLGALLRKARERLAGGGSAEEALWDLWDGTP
FT                   WPTRLERSARRGGAAGRNADRDLDAVCALFATAARAEERTGGRGALNFLEEIDAEDIAA
FT                   DTLARRAVRPDAVRLMTAHRSKGLEWRLVVVAGVQEGLWPDLRRRGSLLEADRIGRDGL
FT                   AEPLSPGALLAEERRLFYVAATRARERLVVTAVKAPADDGDQPSRFLTELGVEPADVTG
FT                   RPRRPLAVAALVAELRATTVDPRVSEPLREAAARRLARLAALTDEDGRPLVPSAHPYRW
FT                   WGMWDPTESKVPLRDRDQPVTLSGSALDQLANTCALQWFLGREVKADAPATTAQGFGNV
FT                   VHVLADEVASGHTPADLAVLMERLDSVWNALAFDAPWKSAQEKANARVALERFLKWHVM
FT                   DRAGRTPVASEHDFDVTLEAGEYEVRIRGQMDRVETDADGRAYVVDFKTGKQAPTSSEV
FT                   ARHPQLAVYQLAVREGAVDEAFDGVRPQPGGAELVHLRQGAPKRDGGETLPKVQAQESQ
FT                   EGPEGEWVGDLLATAAGKVLDERFTPTAGQHCTHCSFRASCSARPEGRHVVE"
     gtgagctcct cttcctccag cggacacccg tcgcaccccc aggtgcgacg ggggagccgt        60
     ggcgcttacc gactggtgcg taccccgccg gctcgcacgg acccccctcg tctggacgcc       120
     gcacagcgcg ccgtggttga ccaccgctcc ggaccgctgc tcgtcctggc ggggccgggc       180
     accgggaaga ccaccaccct ggtcgagtcg gtggcggacc ggatcgccag gggcggcgac       240
     cccgagcgca tcctggtgct caccttcagc cgcaaggcgg ccgtcgagct gcgcgaccgg       300
     atggcgctgc gcatcggtgc cgcgcgggcg ccccgggcga cgacctttca ctcgttcggc       360
     tacgccctgg tccgcgccca ccaggacagc gacctgttcg tggagccgct gcgcctgctg       420
     tccggcccgg agcaggacgt gacggtgcgc gagctgctcg ccgggcaggt ggacctggag       480
     cggctcgggc tcgcccatgt gcgctggccc gacgagctgc gggcctgcct gaccacccgc       540
     ggcttcgccg acgaggtccg cgcggtgctc gcccgcagcc gcgaactggg actcggcccg       600
     gacgcgctcg cggccttcgc ccgccgcatc ggccgccccg actggcgcgc cgccgccgtc       660
     ttcctcgccg agtacctcga cgtgctggac ctccagggcg tgctcgacta cgccgaactg       720
     gtccaccgcg cggtgctcct cgcccgccgc cccgaggtcg ccgcgcacct gaccgcccag       780
     tacgacgcgg tgtacgtcga cgagtaccag gacaccgacc ccgcccaggt acggctgctg       840
     cacgcgctgg cggacggtgg gcgcaccctc gtcgccttcg gcgaccccga ccagtcgatc       900
     tacgccttcc ggggcgcgga cgtgaacggc atcctggact tcccgaccgc cttcccgcgc       960
     gcggacggcc gtccggcgcc ggtcggggta ctgcggaccg cccgccggtc cgggtccggc      1020
     ctgctggccg ccaccaggct gctgacccag cgcatgccac tgacccgcct ccccgccgac      1080
     aaggtgcgtg cccaccgtga gctgacaccg gtgcggggcg gcgggcgggt cgaggcgtac      1140
     acgtatccga ccgccggtac cgaactggac aacatcgccg acatcctgcg ccgggcgcac      1200
     ctggaggacg gcgttccgtg gcgcgacatg gccgtcctgg tacgcgccgg ctcgcgcacc      1260
     atccccacgc tccgccgtgc cctcacctcg gccggcgtcc ccctggacat cgacggcgac      1320
     gacctccccc tgcgccacga gcccgcggtg gcgcccctgc tgacggcgct gcgcgccgtg      1380
     gcggaggcgg aggccgacac gggggcccgg acgggggagc ggttcggggc gctcgggtcc      1440
     gaggccgacg ccgatccgcg cgccgacgcc gacgccgacg ccgacgccga cgccgacgcg      1500
     tacgtggacg ccgacgccga cgcgtacgtg gacgagggcg gagacgcggc gacgaagctc      1560
     tcgcgcggtg aacacgcgta ccgcgcggac gagccgtgct ggctgtccac cgagacggct      1620
     ctcaccctgc tcacctcacc cctcgccggg atggacgccg ccgacctgcg ccgcctcggc      1680
     cgtgccctgc gcgacgagcg gcgcgccgcg ggcaacccgc tgccgccgcc ctcggacgaa      1740
     ctgctcgcac aggcactggc cgagccggag cggctcgccg tgcacgaccc cgcgtacgcg      1800
     cgcggcgccc agcggctcgg cgcgctcctc cgcaaggccc gtgagcgcct ggcgggaggc      1860
     ggcagcgccg aggaggcgct gtgggacctg tgggacggga ccccctggcc cacccgcctg      1920
     gagcgctccg cccggcgcgg cggcgccgcc gggcgcaacg ccgaccgcga cctggacgcc      1980
     gtgtgcgccc tgttcgcgac cgccgcccgc gcggaggagc gcaccggtgg ccggggcgcc      2040
     ctgaacttcc tggaggagat cgacgccgag gacatcgcgg ccgacacgct cgcgcggcgc      2100
     gcggtacgcc ccgacgccgt ccgcctgatg acggcgcacc gctccaaggg gctggagtgg      2160
     cggctcgtcg tcgtggccgg cgtccaggag ggcctgtggc cggacctgcg ccgccgcggc      2220
     tccctcctgg aggccgaccg gatcggccgc gacggactcg ccgaacccct cagccccgga      2280
     gcactgctcg ccgaggagcg ccgactgttc tacgtggccg ccacgcgcgc gcgtgaacgg      2340
     ctcgtcgtga ccgcggtgaa ggcaccggcc gacgacgggg accagccgtc ccgcttcctg      2400
     accgaactcg gcgtcgaacc cgccgatgtc acgggccgtc cgcgccgccc cctcgccgtc      2460
     gcggcgctcg tcgcggaact gcgcgccacc accgtcgacc cccgcgtctc cgagccgctg      2520
     agagaggcag ccgcgcgccg tctggcccgc ctcgccgccc tgaccgacga ggacggccgt      2580
     cccctggtgc cgtccgccca cccctaccgc tggtggggca tgtgggaccc gaccgagagc      2640
     aaggtgccgc tgcgcgaccg cgaccagccc gtcacgctct ccggcagtgc cctggaccag      2700
     ctggccaaca cctgcgccct gcagtggttc ctgggccgtg aggtgaaggc cgacgcgccc      2760
     gcgacgaccg cccaggggtt cggcaacgtg gtgcacgtgc tcgccgacga ggtggcctcc      2820
     ggacacaccc cggccgacct cgccgtcctc atggagcgcc tggactccgt gtggaacgcg      2880
     ctcgccttcg acgcgccgtg gaagtcggcc caggagaagg ccaacgcgcg cgtggcgctg      2940
     gaacgcttcc tgaagtggca cgtcatggac cgcgccggac gcaccccggt ggcgagcgag      3000
     cacgacttcg acgtgaccct ggaggcgggc gagtacgagg tgcgcatccg gggccagatg      3060
     gaccgcgtgg aaaccgacgc cgacggccgc gcctacgtcg tggacttcaa gaccggcaaa      3120
     caggcgccca cctcatcgga ggtggcccgc cacccccagc tcgccgtgta ccagctcgcc      3180
     gtccgcgagg gcgccgtcga cgaggccttc gacggcgtgc gcccgcaacc gggcggcgcc      3240
     gagctcgtcc acctgcgcca gggcgcgccc aagcgggacg gcggcgagac cctgcccaag      3300
     gtgcaggcac aggagtcgca ggagggaccg gagggcgagt gggtcggcga cctgctggcc      3360
     acggccgccg gcaaggtcct ggacgaacgg ttcaccccga ccgcgggcca gcactgcacc      3420
     cactgctcgt tccgcgcgtc gtgcagcgct cgccccgagg ggcggcacgt cgtggagtga      3480
//

If you have problems or comments...

PBIL Back to PBIL home page