(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5184

AL939122.SCO5184     Location/Qualifiers
FT   CDS_pept        268145..271813
FT                   /transl_table=11
FT                   /gene="SCO5184"
FT                   /gene_synonym="2SC3B6.08"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.08, possible ATP-dependent DNA helicase, len:
FT                   1222 aa; similar to TR::O53347 (EMBL:AL021646)
FT                   Mycobacterium tuberculosis putative ATP-dependent DNA
FT                   helicase, MTV014.45c, 1101 aa; fasta scores: opt: 1209
FT                   z-score: 1062.9 E(): 0; 38.4% identity in 1199 aa overlap
FT                   to SW:HELD_ECOLI (EMBL:J04726) Escherichia coli helicase IV
FT                   (EC 3.6.1.-) HelD, 648 aa; fasta scores: opt: 216 z-score:
FT                   194.6 E(): 0.0023; 25.3% identity in 471 aa overlap and to
FT                   Streptomyces coelicolor 2SC3B6.07, 1159 aa; fasta scores:
FT                   opt: 406 z-score: 293.0 E(): 1e-10; 30.2% identity in 977
FT                   aa overlap. Contains Pfam match to entry PF00580
FT                   UvrD-helicase, UvrD/REP helicase and match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FCK4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK4"
FT                   /protein_id="CAC01314.1"
FT                   /translation="MWPDRSRPGPPEPPRRAAGVTRRTTRADLHFPPTREDIRHQLSVA
FT                   AASLSDVPAHITDPEQLKELLGIPFTPEQTACIVAPPAPQVIVAGAGSGKTTVMAARVV
FT                   WLVGTGQVAPEQVLGLTFTNKAAGELAERVRTALIRAGVTDPDVIDPDHPPGEPAISTY
FT                   HAFAGRLLTDHGLRLGLEPTSRLLADATRYQLAARVLREAPGPYPALTRSFADLVSDLL
FT                   ALDGELAEHLVRPEDLRAWDAGLLDTLDGVRLSNADLRKVPEAAAARRELADLVIRYRA
FT                   AKRRQDLLDFGDQIALSAQLAGLPEVGRVLRDDYRVVLLDEYQDTSVAQRILLAGLFGG
FT                   GTGHPVTAVGDPCQAIYGWRGASVANLDDFPEHFAHADGRPAARQALSENRRSGGRLLD
FT                   LANGLAEPLRAMHAGVEALRPAPGAERDGMVRCALLSTHAEEIDWIADSVAHLVRTGKA
FT                   PGEIAVLCRTATDFAEIQGALVARDVPVEVVGLSGLLHLPEVADLVAVCEVLQDPGANA
FT                   SLVRLLSGPRWRVGPRDLALLGRRARLLVSHARVEGDDDPDRRLAEAVEGVDPSEVISL
FT                   ADALDTFLETPLDGTGDDDGLPFSADARVRFARLATELRELRRALSDPLMDVLHRVLAV
FT                   TGLEVELSASPHALAARRRETLSNFLDVAASFAAGDGEATLLAFLGFLRTAAQYEKGLD
FT                   NALPGGENTVKVLTAHKSKGLEWDVVAVPGLVTGTFPSGQGREKWTAQGKVLPHGLRGD
FT                   AETLPDVASWDARGLKAFHEAMKDHQHTEELRLGYVTFTRPRSLLLGSGHWWGPSQKKP
FT                   RGPSDFLTALYEHCAAGHGEIEVWADEPAEDEENPALHRATADEVWPLPLDDAALARRR
FT                   SAAETVLAHLDGLAAREDGPPSAPATYEDPDWPPPPEDDEGLPEEAEPDRAGDPAHWDS
FT                   WTTERPAAAREAATAPESPAAPQAGPTVPHQAPPPEQPPGTAPVPAPARLTPEEARTVA
FT                   SWDRDLDALTGELLRARESVTEVPLPASLTASQLLSLAADPDGFAQELARPMPRPPQPA
FT                   ARRGTRFHAWVEARFEPLTLPLLEPEELPGGDAEIADDHDLEFLKDAFERTEYARRTPF
FT                   RVEAPFQLSLAGRVVRGRIDAVYKEGDGDTATYEIVDWKTNRAATADPLQLALYRIAWA
FT                   EQQHVPPASVTAAFLYVRTGEVVRPEGLPDRAALEKLLLAEPVGDEPHDRGVRAGR"
     gtgtggccgg accggagccg ccccggccca ccggagccgc cgcgccgagc ggccggtgtg        60
     acacgtcgca ccacgcgggc tgacctgcac ttccctccga cccgagagga catccggcac       120
     cagctgtcag tggccgccgc tagcctctct gacgtgcccg cccacatcac cgatcccgag       180
     cagctcaagg agctcctcgg catccccttc acccccgagc agacggcctg catcgtcgcg       240
     ccgcccgcgc cgcaggtgat cgtggccgga gccgggtccg gcaagacgac ggtgatggcg       300
     gcacgcgtgg tgtggctggt cggcaccggc caggtcgccc cggagcaggt cctcgggctc       360
     accttcacca acaaggcggc cggcgagctc gccgaacgcg tccgtacggc cctgatcaga       420
     gcgggcgtga ccgacccgga cgtgatcgac ccggaccacc cgccgggcga gcccgcgatc       480
     tcgacgtacc acgccttcgc gggccgcctc ctgaccgacc acggcctgcg tctcggcctt       540
     gagccgacct cccgcctgct cgccgacgcc acccgctacc agctcgccgc gagggtcctg       600
     cgcgaggccc ccggccccta cccggcgctc acccggtcct tcgccgacct ggtcagcgac       660
     ctccttgccc tcgacggcga actggccgag cacctcgtgc gccccgaaga cctgcgcgcc       720
     tgggacgccg gtctcctgga caccctggac ggcgtccggc tcagcaacgc cgacctgcgc       780
     aaggtccccg aggccgccgc cgcccgccgc gaactggccg acctggtgat ccgctaccgg       840
     gccgccaaac gccggcagga cctgctcgac ttcggcgacc agatcgccct gtccgcgcag       900
     ctcgccggac tccccgaggt gggccgcgtc ctgcgcgacg actaccgggt cgtgctgctg       960
     gacgagtacc aggacacctc cgtggcccag cgcatcctcc tcgcgggcct gttcggcggc      1020
     ggcaccggcc atcccgtgac cgccgtgggc gacccctgcc aggcgatcta cggctggcgc      1080
     ggcgcctccg tcgccaacct ggacgacttc cccgaacact tcgcccacgc cgacggacgg      1140
     cccgcggccc gccaggcgct cagcgagaac cgccgcagcg gcggccgcct cctcgacctc      1200
     gccaacggcc tcgccgagcc cctgcgggcc atgcacgcgg gcgtggaggc actgcggccc      1260
     gccccgggcg ccgaacgcga cggcatggtc cgctgcgccc tgctgagcac ccacgccgag      1320
     gagatcgact ggatcgccga ctccgtcgcc cacctcgtgc gcaccggcaa ggcgcccggt      1380
     gagatcgccg tcctgtgccg cacggcgacc gacttcgcgg agatccaggg cgcgctggtg      1440
     gcccgtgacg tccccgtgga ggtcgtcggc ctgtccgggc tgctgcacct gcccgaggtg      1500
     gccgacctgg tcgccgtctg cgaagtcctc caggacccgg gtgccaacgc ctctctggtc      1560
     cggctgctct ccggcccgcg ctggcgcgtc ggcccgcgcg acctcgccct cctgggacgc      1620
     cgcgcccggc tgctggtgag ccacgcgcgc gtggagggcg acgacgaccc cgaccggagg      1680
     ctcgccgagg cggtcgaggg ggtcgacccg tccgaggtga tatcgctcgc ggacgccctg      1740
     gacaccttcc tggagacgcc gctggacggc accggcgacg acgacgggct gcccttctcg      1800
     gcggacgcgc gcgtgcggtt cgcccggctc gccaccgaac tgcgcgagct gcgccgagcc      1860
     ctgtccgacc cgctcatgga cgtcctgcac cgcgtcctcg ccgtcaccgg cctggaggtc      1920
     gagctgtcgg cgtccccgca cgccctggcg gcccgtcgcc gcgagaccct gtcgaacttc      1980
     ctcgacgtcg ccgcgtcctt cgccgcgggc gacggcgagg ccaccctgct cgccttcctg      2040
     ggcttcttgc gcaccgccgc gcagtacgag aagggcctgg acaacgcgct gcccggcggg      2100
     gagaacaccg tcaaggtact gaccgcgcac aagtccaagg gcctcgagtg ggacgtcgtc      2160
     gccgtgcccg gtctcgtcac cggcaccttc cccagcggtc agggccggga gaagtggacc      2220
     gcccagggca aggtgctgcc gcacggcctg cgcggcgacg ccgagaccct gcccgacgtc      2280
     gcctcctggg acgcccgcgg tctgaaggcg ttccacgagg ccatgaagga ccaccagcac      2340
     accgaggagc tccgcctcgg ctacgtcacc ttcacgcgcc cccgctccct gctcctcggc      2400
     tccggccact ggtgggggcc cagccagaag aagccccgcg gtccgtccga cttcctgacg      2460
     gccctgtacg agcactgcgc ggccggacac ggcgagatcg aggtctgggc ggacgaaccg      2520
     gcggaggacg aggagaaccc cgccctgcac cgggcgaccg ccgacgaggt ctggccgctg      2580
     cccctggacg acgcggcact cgcgcggcgc cgttcggccg ccgagacggt cctcgcccac      2640
     ctggacggac tcgccgcccg ggaagacggt cccccctccg cccccgccac ctacgaggac      2700
     ccggactggc cgccgccccc ggaggacgac gagggactcc cggaggaagc ggagcccgac      2760
     cgggccgggg accccgccca ctgggacagc tggaccacgg agcgccccgc cgccgcgcgg      2820
     gaggccgcca ccgcgccgga gagccctgcc gccccgcagg ccggccccac cgtcccgcac      2880
     caggcgccgc cccccgaaca gcccccgggc accgcgcccg tccccgctcc cgctcgcctc      2940
     acaccggagg aggcccgcac cgtcgcctcc tgggaccgcg acctcgacgc gctcaccgga      3000
     gagctcctgc gcgcccgcga gagcgtcacc gaagtgcccc ttccggcgtc gctgaccgcc      3060
     tcccagctgc tgagcctggc cgccgacccg gacgggttcg cccaggagct ggcccggccc      3120
     atgccccgcc cgccccagcc cgccgcccgc cgcggcaccc gattccacgc ctgggtggag      3180
     gcccggttcg aaccgctgac cctgccgttg ctcgaaccgg aagagttgcc cggcggcgac      3240
     gccgagatcg ccgacgacca cgacctggag ttcctgaagg acgccttcga gcgcaccgag      3300
     tacgcccgcc gcaccccgtt ccgtgtcgag gcgccgttcc agctctcgct cgccgggcgg      3360
     gtcgtacgcg gccgcatcga cgccgtctac aaggagggcg acggcgacac cgcgacgtac      3420
     gagatcgtcg actggaagac caaccgcgcc gccaccgccg acccgctcca gctcgcgctc      3480
     taccgcatcg cctgggccga acagcagcac gtaccgcccg cctcggtgac ggccgccttc      3540
     ctgtacgtac gcaccggcga ggtcgtacgg cccgaggggc tgccggaccg cgcggcgctc      3600
     gagaagctgc tgctggccga gccggtcggt gacgaaccgc acgaccgggg tgtccgcgcg      3660
     ggccgatag                                                              3669
//

If you have problems or comments...

PBIL Back to PBIL home page