(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5185

AL939122.SCO5185     Location/Qualifiers
FT   CDS_pept        271824..273236
FT                   /transl_table=11
FT                   /gene="SCO5185"
FT                   /gene_synonym="2SC3B6.09"
FT                   /product="putative peptidase"
FT                   /note="2SC3B6.09, possible peptidase, len: 470 aa; similar
FT                   to TR:AAF73713 (EMBL:AE002246) Chlamydophila pneumoniae
FT                   AR39 peptidase, M20/M25/M40 family CP0876, 439 aa; fasta
FT                   scores: opt: 809 z-score: 938.0 E(): 0; 33.6% identity in
FT                   455 aa overlap. Contains Pfam match to entry PF01546
FT                   Peptidase_M20, Peptidase family M20/M25/M40"
FT                   /db_xref="GOA:Q9FCK3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK3"
FT                   /protein_id="CAC01315.1"
FT                   /translation="MSHPVDNAVSAVRTYIEQHRAAFLDDLVEWLRIPSVSAQPDHATD
FT                   VRRSADWLAAKLKETGFPTAEVWPTRGAPAVFAEWPSGDPQAPTVLVYGHHDVQPAARE
FT                   DGWTSEPFDPVVRENRLYARGAADDKGQVFFHTLGVRAHLAATGRKAPAVNLKLLIEGE
FT                   EESGSPHFRALVEERAERLTADAVVVSDTGMWSEDTPTVCTGMRGLAECEIRLHGPDQD
FT                   IHSGSFGGAVPNPATAVARLVAALHDEHARVAIPGFYDGVADLTDRERELFAELPFDER
FT                   QWLRTAKSYAAHGEAGHTTLERIWARPTAEVNGIGGGYQGPGSKTIIPSSAMVKLSFRL
FT                   VAGQDPDHVEKAVRTWADEQVPAGIRCEVVFGSATRPCLTPLDHPALRSVVRAMGRAFD
FT                   KPVRFTREGGSGPAADLQEVLGAPVLFLGISVPSDGWHAPDEKVELDLLLKGVETAAHL
FT                   WGDLGEHWRHAP"
     atgagccacc ccgttgacaa tgctgtcagc gctgtccgca cgtacatcga gcagcaccgc        60
     gccgccttcc tcgacgacct cgtcgaatgg ctgcgcatcc cgtccgtgtc ggcccagccc       120
     gaccacgcga ccgatgtgcg ccgcagcgcc gactggctcg ccgccaagct gaaggagacc       180
     ggcttcccga ccgcggaggt ctggccgacc cggggcgccc ccgcggtgtt cgccgagtgg       240
     ccctccgggg acccgcaggc accgacggtc ctcgtctacg gccaccacga cgtacagccc       300
     gccgcccgcg aggacggctg gaccagcgag cccttcgacc ccgtcgtccg cgagaaccgc       360
     ctctacgcgc gcggggcggc cgacgacaag gggcaggtgt tcttccacac actcggcgtc       420
     cgcgcccacc tcgccgccac cggccgtaag gctccggcgg tgaacctcaa actgctgatc       480
     gagggcgaag aggaatccgg ttccccgcac ttccgtgccc tcgtcgagga gcgcgccgag       540
     cggctcaccg ccgacgcggt cgtcgtctcc gacacgggta tgtggtccga ggacaccccc       600
     accgtctgca ccggcatgcg gggcctcgcc gagtgcgaga tccggctgca cggacccgat       660
     caggacatcc actcgggctc cttcggcggc gccgtcccca acccggccac cgccgtcgcg       720
     cgcctcgtcg ccgccctgca cgacgagcac gcgcgcgtgg cgatacccgg cttctacgac       780
     ggagtggccg acctcaccga ccgcgagcgc gagctcttcg ccgagctgcc cttcgacgag       840
     cggcagtggc tgcgcacggc caagtcgtac gccgcccacg gcgaagccgg acacaccacc       900
     ctggagcgca tctgggcccg ccccaccgcc gaggtcaacg gcatcggcgg cggctaccag       960
     ggccccggaa gcaagacgat catcccgtcg tccgccatgg tgaagctctc cttccgcctc      1020
     gttgcgggcc aggaccccga tcacgtggag aaggccgtcc gcacctgggc cgacgagcag      1080
     gtacccgcgg gcatccgctg cgaggtcgtc ttcggctccg ccacccgccc gtgcctgacg      1140
     ccgctggacc acccggcgct gcggtcggtc gtccgcgcga tgggacgggc cttcgacaaa      1200
     ccggtccgct tcacccgcga gggcggctcc ggcccggccg ccgacctcca ggaggttctc      1260
     ggcgccccgg tgctcttcct gggcatctcg gtcccgtccg acggctggca cgcccccgac      1320
     gagaaggtgg aactggacct gctcctcaag ggcgtcgaaa ccgccgccca cctctggggc      1380
     gacctggggg agcactggcg tcacgcgccc tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page