(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5186

AL939122.SCO5186     Location/Qualifiers
FT   CDS_pept        273386..274342
FT                   /transl_table=11
FT                   /gene="SCO5186"
FT                   /gene_synonym="2SC3B6.10"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.10, conserved hypothetical protein, len: 318
FT                   aa; similar to TR:O53345 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 33.8 kD protein MTV014.43c, 313
FT                   aa; fasta scores: opt: 334 z-score: 389.2 E(): 3.3e-14;
FT                   33.3% identity in 318 aa overlap"
FT                   /db_xref="GOA:Q9FCK2"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK2"
FT                   /protein_id="CAC01316.1"
FT                   /translation="MEAPVTTWTDHTADRPISLTAPSGVDRAAHHRLDEAWLAAAWSHP
FT                   STRCFVVSGGQVLIDETPDGATELVMTPSFEAPLTEAHRYFLGTDEDGTSYFALQKDSL
FT                   PGRMDQSARPAGLREAGLLLSPRDAGLMAHAVALENWQRLHRFCSRCGERTVIAAAGHI
FT                   RRCPACGAEHYPRTDPAVIMAVTDGEDRILLGRQVHWARGPLLDPRRFRGARRVHRAVG
FT                   APRGPGGGRRHRRPGRVRREPAVAFPSSLMLGFMAHATSTEIDVDGDEIHEARWFSREE
FT                   LGAAFESGEVLPPYGISIAARLIELWYGRPLPTRSAF"
     ttggaagcac ccgtgaccac ctggaccgac cacaccgccg accgtcccat ctcgctcacc        60
     gcccccagcg gcgtcgaccg cgccgcccac caccgcctcg acgaggcctg gctcgcggcg       120
     gcgtggagtc acccctcgac gcgctgcttc gtggtctccg gcggccaggt cctcatcgac       180
     gagacgcccg acggggccac cgaactcgtc atgaccccct ccttcgaggc cccgctcacc       240
     gaggcacacc gctacttcct gggcaccgac gaggacggca ccagctactt cgccctccag       300
     aaggactccc tgcccggccg catggaccag tccgcgcgcc ccgccggcct gcgcgaggcc       360
     ggcctgctcc tgtccccccg cgacgccggg ctgatggccc acgcggtagc cctggagaac       420
     tggcagcgcc tgcaccggtt ctgctcccgc tgcggagaac gcaccgtcat cgccgcggcc       480
     ggccacatcc gccgttgccc cgcctgcggt gccgagcact acccgcgcac cgaccccgcg       540
     gtgatcatgg cggtcacgga cggtgaggac cgcatcctgc tcggccgcca ggtgcactgg       600
     gcccgagggc cgcttctcga ccctcgccgg tttcgtggag cccggcgagt ccatcgagca       660
     gtcggtgcgc cgcgaggtcc aggaggaggt cggcgtcacc gtcggcccgg tcgagtacgt       720
     cgcgagccag ccgtggcctt cccgtccagc ctgatgctcg gcttcatggc ccacgccacg       780
     tcgaccgaga tcgacgtgga cggcgacgag atccacgagg cccgctggtt ctcccgcgag       840
     gagctgggcg ccgccttcga gtccggcgag gtcctgccgc cctacggcat ctcgatcgcg       900
     gcccgcctca tcgagctctg gtacggcagg ccactgccga cgcgcagcgc cttctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page