(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5188

AL939122.SCO5188     Location/Qualifiers
FT   CDS_pept        274716..277073
FT                   /transl_table=11
FT                   /gene="SCO5188"
FT                   /gene_synonym="2SC3B6.12"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.12, probable ATP-dependent DNA helicase, len:
FT                   785 aa; similar to SW:UVRD_ECOLI (EMBL:M87049) Escherichia
FT                   coli DNA helicase II (EC 3.6.1.-) UvrD, 720 aa; fasta
FT                   scores: opt: 649 z-score: 632.5 E(): 9.2e-28; 31.6%
FT                   identity in 643 aa overlap. Contains 2x Pfam matches to
FT                   entry PF00580 UvrD-helicase, UvrD/REP helicase, Pfam match
FT                   to entry PF00570 HRDC, HRDC domain and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FCK0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK0"
FT                   /protein_id="CAC01318.1"
FT                   /translation="MRSHGVNVRGGTTIPVAHSHRVMPVALIRLSVRACGQPTHPSRET
FT                   WQHGGVTAATHSTLFPQVPDSADAVLEGLDLEQREVATALRGPVCVLAGAGTGKTRAIT
FT                   HRIAYGVRAGILQPSSVLAVTFTNRAAGEMRGRLRQLGASGVQARTFHSAALRQLQYFW
FT                   PKAIGGSLPRLVDRKIQLVADAAAACRIRLDRGELRDVTAEIEWSKVTQTVPADYAPAA
FT                   AKAGREAPRDPAEIAQLYAAYEDLKRARSVIDFEDVLLLTVAVLQDRHDVAEQVRAQYQ
FT                   HFVVDEYQDVSPLQQRLLELWLGDRDDLCVVGDASQTIYSFTGATPDHLLDFRGRHPGA
FT                   TVVKLVRDYRSTPQVVHLANGLLAQARGRAADHRLELVSQRPAGPEPGYAEYSDEPAEA
FT                   EGAARRIRELIDSGVPAAEIAVLFRTNSQSETYEQALADAGVPYQLRGAERFFDRPEVR
FT                   KAGSALRAAARFGGNDSLLDDAVDLPSQVRAVLSGEGWTTQPPAGSGAVRERWESLAAL
FT                   VGLAQDFAAARAGATLSDLVVELDERAGAQHAPTVQGVTLASLHSAKGLEWDVVFLVGV
FT                   AEGMMPITYAKTDEQIEEERRLLYVGVTRARERLHLSWALARSPGGRPNRRPSRFLKGL
FT                   RPGSGTAGGQAAAAGAGGVERGIRGGGGGGAAAAPRRTQRTPARCRVCGRTLTDAGEMK
FT                   LMRCEGCPSDMDEGVYERLREWRAVQAGRSGQPAFCVFTDKTLMAIAESVPEDERELAR
FT                   IPGVGMRKLNRYGTDVLAICAGQEGVGLDEDD"
     atgaggtcgc acggagtgaa cgtccgtggc ggcacgacca ttcccgtcgc gcactcgcac        60
     cgcgtgatgc ctgtcgcatt gatacgactg tcagtgcgtg cctgtggaca accgactcac       120
     ccgtcccgcg agacctggca gcatggcggt gtgacagcag caacgcactc caccctcttc       180
     ccgcaggtac cggactcggc cgacgcggtg ctcgaagggc tcgacctcga gcagcgcgag       240
     gtggcgaccg ccctgcgcgg cccggtgtgc gtgctggcgg gagccggcac gggcaagacc       300
     cgcgcgatca cccatcgcat cgcctacggg gtgcgcgccg ggatcctcca gccttccagc       360
     gtgctcgccg tcaccttcac caaccgtgcg gccggcgaga tgcgcggtcg gctgcgccag       420
     ctcggcgcct ccggtgtgca ggcccgcacc ttccactcgg cggcgctgcg acagctccag       480
     tacttctggc cgaaagcgat cggcggttcc ctgccccggc tcgtcgaccg caagatccag       540
     ctcgtcgccg acgcggccgc cgcctgccgc atccgcctcg accgcggcga gctgcgtgac       600
     gtcaccgcgg agatcgagtg gtccaaggtg acccagacgg tgcccgccga ctacgccccg       660
     gcggctgcca aggccggccg tgaggcgccc cgcgacccgg cggagatcgc gcagctgtac       720
     gccgcctacg aggacctcaa gcgtgcgcgc tccgtcatcg acttcgagga cgtgctgctg       780
     ctgacggtgg ccgtcctcca ggaccggcac gatgtcgccg agcaggtccg cgcccagtac       840
     cagcacttcg tggtcgacga gtaccaggac gtcagcccct tgcagcagcg tctgctggag       900
     ctgtggctcg gggaccgcga cgacctgtgc gtggtcggcg acgccagcca gacgatctat       960
     tcgttcacgg gagcaacccc cgaccatctg ctcgacttcc gcggccgcca ccccggcgcc      1020
     accgtcgtca agctggtccg cgactaccgt tccacccccc aggtcgtcca cctcgccaac      1080
     ggcctgctcg cccaggcccg gggccgggcc gccgatcacc gcctggagct ggtctcccag      1140
     cggcccgcgg gccccgagcc cggctacgcc gagtactccg acgagccggc cgaggccgag      1200
     ggcgccgccc gccgcatccg cgaactcatc gactcgggcg ttccggccgc cgagatcgcg      1260
     gtcctgttcc ggaccaactc ccagtcggag acctatgagc aggcactcgc cgacgccggg      1320
     gtcccgtacc agttgcgggg cgcggagcgc ttcttcgacc ggcccgaggt gcgcaaggcc      1380
     ggcagtgccc tgcgggccgc cgcccgcttc ggcggcaacg actccctcct cgacgacgcc      1440
     gtcgacctgc cctcgcaagt gcgcgcggtg ctgtccgggg agggctggac gacccagccc      1500
     ccggccgggt cgggcgccgt ccgggagcgg tgggagtcgc tggccgccct ggtgggactg      1560
     gcccaggact tcgccgccgc cagagcggga gccacgctga gcgacctcgt cgtggaactc      1620
     gacgagcgcg cgggcgccca gcacgccccg acggtgcagg gcgtcaccct cgcctccctg      1680
     cactcggcca agggcctgga gtgggacgtc gtgttcctgg tcggcgtcgc cgagggcatg      1740
     atgccgatca cctacgcaaa gaccgacgag cagatcgagg aggaacgtcg ccttctctac      1800
     gtcggtgtca cccgcgcgcg tgaacgcctg cacctgtcct gggcactggc ccggtcgccc      1860
     gggggccggc cgaaccgcag gcccagccgc tttctgaagg ggctgcggcc cggttcgggc      1920
     acggcgggcg gacaggcggc cgccgcgggt gccgggggcg tggagcgcgg gatccgaggg      1980
     ggcggcggtg gtggcgcggc cgccgcgccg agacggaccc agcggacgcc cgcccgctgc      2040
     cgggtctgcg gacgcacgct caccgacgcc ggtgagatga agctgatgcg ctgcgagggg      2100
     tgcccgtcag acatggacga gggcgtctac gagcggttgc gggagtggcg ggcggtgcag      2160
     gcggggcgca gcggacagcc cgcgttctgc gtcttcaccg acaagacgct gatggcgatc      2220
     gccgagtccg tcccggagga cgagcgggag ctggccagga tcccgggggt cgggatgcgc      2280
     aagctcaatc gctacgggac cgacgtcctg gccatctgcg caggccagga aggcgtgggg      2340
     cttgacgagg acgactga                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page