(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5192

AL939122.SCO5192     Location/Qualifiers
FT   CDS_pept        complement(278569..279978)
FT                   /transl_table=11
FT                   /gene="SCO5192"
FT                   /gene_synonym="2SC3B6.16c"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.16c, hypothetical protein, len: 469 aa;
FT                   similar to TR:O53343 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis ABC-transporter ATP binding protein MTV014.41,
FT                   447 aa; fasta scores: opt: 1156 z-score: 1301.9 E(): 0;
FT                   45.3% identity in 393 aa overlap"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ6"
FT                   /protein_id="CAC01322.1"
FT                   /translation="MSDLPRKAVTRTAKLAALPLGFAGRATWGLGKRIVGESAEIVGQQ
FT                   LQQRTAEQLFKVLGELKGGAMKFGQALSVFESALPEEVAGPYRAALTKLQEAAPPMPTR
FT                   TVHSVLAERLGEDWQELFLEFEDKPAAAASIGQVHRGVWQDGREVAVKVQYPGAGEALL
FT                   SDLNQLSRFARLLGPLVPGMDIKPLITELKDRVSEELDYDLEAQAQRTHAEVFDDDPDI
FT                   VVPDVIHQCEQVLITEWIDGIPMSEIISNGTQEQRDRAGQLLAHFLFSGPARTGLLHAD
FT                   PHPGNFRLLPGGPRGEDDWRLGVLDFGTVDRLPGGLPEPIGEALRMTLDGEAEAVYEML
FT                   CAEGFVKESIELAPDAVLEYLLPIIEPARVDAFTFTRGWMRSQAARIGDPRSPAYQLAK
FT                   QLNLPPAYLLIHRVTLSTIGVLCQLGATVRLRDELEEWLVGFVAEGEAEVEEGEEADED
FT                   VYETEGTAAEA"
     atgtctgatc ttccgcgcaa ggcggtcacc cggaccgcca agctcgccgc gctcccgctc        60
     ggcttcgccg ggcgggccac ctgggggctg ggcaagcgaa tcgtcggcga gtccgcggag       120
     atcgtcggcc agcagctgca gcagcgcacc gcggagcagt tgttcaaggt gctgggcgag       180
     ctcaagggcg gggcgatgaa gttcgggcag gccctgtccg tcttcgagtc ggcactgccc       240
     gaggaggtcg ccggccccta tcgtgcggcg ctgaccaagc tgcaggaggc ggcaccgccg       300
     atgccgacgc gcaccgtgca ctccgtgctg gcggagcggc tcggtgagga ctggcaggag       360
     ctgttcctgg agttcgagga caagcccgcc gcggccgcct cgatcggcca ggtgcaccgg       420
     ggggtgtggc aggacggccg cgaggtggcg gtcaaggtgc agtacccggg cgccggcgag       480
     gcactgctgt ccgacctgaa ccagctcagc cgcttcgccc gcctgctcgg cccgctggtc       540
     cccggcatgg acatcaagcc gctgatcacg gagctgaagg accgggtctc ggaggagctg       600
     gactacgacc tggaggcgca ggcccagcgg acgcatgccg aggtcttcga cgacgacccg       660
     gacatcgtgg taccggacgt catccaccag tgcgagcagg tgctgatcac cgagtggatc       720
     gacggcatcc cgatgtcgga gatcatctcg aacggcacgc aggagcagcg cgaccgggcg       780
     ggtcagttgc tcgcccactt cctgttctcc ggtcccgcgc gcaccgggct cctgcacgcc       840
     gacccgcacc ccggcaactt ccggctgctg cccggcgggc ctcggggcga ggacgactgg       900
     cgcctgggcg tcctggactt cggcacggtc gaccgccttc cgggcggtct gccggaaccc       960
     atcggcgagg ccctgcgcat gacgctggac ggcgaggcag aggccgtcta cgagatgctc      1020
     tgcgcggaag gcttcgtcaa ggagtcgata gagctggccc ccgacgccgt tctcgagtac      1080
     ctgcttccga tcatcgagcc ggccagggtc gacgcgttca ccttcacccg cggctggatg      1140
     cggagccagg ccgcccgcat cggtgacccc cgctcccccg cgtaccagct ggccaagcag      1200
     ctcaacctgc cgccggcgta tctcctgatc caccgcgtga ccttgagcac catcggtgtg      1260
     ctctgccagc tgggtgccac ggtccggctg cgcgacgagt tggaggagtg gctggtcggg      1320
     ttcgtcgccg agggcgaggc cgaggtggag gaaggcgagg aagcggacga ggacgtgtac      1380
     gagacggagg gaacggccgc ggaggcctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page