(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5193

AL939122.SCO5193     Location/Qualifiers
FT   CDS_pept        complement(279971..281299)
FT                   /transl_table=11
FT                   /gene="SCO5193"
FT                   /gene_synonym="2SC3B6.17c"
FT                   /product="putative secreted protein"
FT                   /note="2SC3B6.17c, possible secreted protein, len: 442 aa;
FT                   similar to TR:O53342 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 31.6 kD protein MTV014.40, 299
FT                   aa; fasta scores: opt: 233 z-score: 233.2 E(): 1.6e-05;
FT                   29.9% identity in 261 aa overlap. Contains possible
FT                   N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q9FCJ5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ5"
FT                   /protein_id="CAC01323.1"
FT                   /translation="MDNFRRLSAQPGMLALAGGFAADGGPAHGHRETYGGPGMHPMVKP
FT                   ALRRGWRDLNTVQFGMTPAHALTLAPVDTATGSFLELLNGTRGPALLREAGHRMDLPDG
FT                   HVDRVVERLALAGLLDDSRGGGPAADALRAKKEVLDRLRPDLASLSLTTSEPGDAIRHL
FT                   AARRALRVGVRGAGRVGAVLAGLLSGAGVGEIDVRDGGRVEPWDVAPGGLPAEAVGDRR
FT                   DETARRLVRRAAPGRPPRRGPTTPPEESAPGLSLVIVAPRDDVAVYTPDPTAAESLMAS
FT                   GTPHLYAGVVEGTGVVGPLVLPGETGCAGCLHAERTGRDPAFPRLVAQWRSGRRHRVPP
FT                   CDLALATTVAGFAAAQALAFLDGRTPSGTGARWEVSLPGLRWQVRPVRPHPSCPCGAAR
FT                   KGKQEHIPEDGGWRATMAGQGPSAEVRHEAERARPAGTWRAHV"
     gtggacaact ttcgacgcct ctccgcgcag ccgggcatgc tggcactcgc cggcggattc        60
     gcggccgacg gcgggcccgc acacggacac cgcgagacat acgggggacc tggcatgcat       120
     ccgatggtga agcccgcgct caggcgcggc tggcgcgatc tgaacaccgt gcagttcggc       180
     atgactccgg cgcacgcgct gaccctggca ccggtggaca cggcgacggg cagcttcctc       240
     gaactgctca acggcacccg cggcccggcg ctgctgcgcg aggcggggca ccgcatggac       300
     ctgccggacg ggcatgtcga ccgggtcgtg gagcgcctgg cgctggccgg tctgctcgac       360
     gactcccggg gcggcgggcc ggccgccgac gcgctgcgcg cgaagaagga ggtcctcgac       420
     cgactccgcc ccgatctggc ctcgctgtcc ctgacgacct cggaaccggg cgacgcgatc       480
     agacacctgg ccgcccgacg cgccctgcgg gtgggtgtgc ggggcgccgg acgagtgggt       540
     gcggtgctgg ccggcctgct gtcgggcgcg ggcgtcggcg agatcgacgt gcgcgacggc       600
     ggacgcgtcg agccgtggga cgtcgctccg ggcggcctgc ccgccgaggc ggtcggcgac       660
     cgccgggacg agacggcccg ccgcctcgtg cgccgggccg ctcccggccg gcctccccgc       720
     cgaggcccga cgacaccgcc cgaggagagc gccccgggcc tctccctggt gatcgtcgcc       780
     ccgcgcgacg acgtcgcggt gtacacgccc gaccccaccg ccgcggaatc cctgatggcc       840
     tccggcacac cccacctcta cgccggtgtc gtggagggaa ccggtgtcgt cggccctctg       900
     gtcctgcccg gcgagacggg gtgcgccgga tgtctgcacg cggagcgtac gggccgggac       960
     cccgcctttc ctcggctggt ggcgcagtgg cgctccggcc ggcggcaccg ggtaccgccc      1020
     tgcgacctcg ctctcgcgac gaccgtcgcc gggttcgcgg cggctcaggc gctcgccttc      1080
     ctggacggca ggacgccctc cggcaccgga gcgcgctggg aggtctcgct gcccggcctg      1140
     cgatggcagg tgcggccggt ccggccacac ccttcgtgcc cctgcggggc ggcccggaaa      1200
     ggtaagcagg aacacatccc cgaggacggg gggtggcgcg cgacaatggc tgggcaaggg      1260
     ccgtcagcgg aagtacgcca cgaggcggaa cgggcgcggc cggctgggac ttggagggcg      1320
     catgtctga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page