(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5194

AL939122.SCO5194     Location/Qualifiers
FT   CDS_pept        281506..282012
FT                   /transl_table=11
FT                   /gene="SCO5194"
FT                   /gene_synonym="2SC3B6.18"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.18, hypothetical protein, len: 168 aa;
FT                   similar to TR:CAB72040 (EMBL:AJ391262) Neisseria
FT                   meningitidis hypothetical 26.6 kD protein RNI5, 230 aa;
FT                   fasta scores: opt: 249 z-score: 315.5 E(): 4.2e-10; 41.7%
FT                   identity in 103 aa overlap"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ4"
FT                   /protein_id="CAC01324.1"
FT                   /translation="MRRSARRRRTVSAYREGDRTVVLIPARMSEAEEQRWVSVMLDKLA
FT                   AQESKRVLGDAELAERAERLSGQYFEGRARPASVRWVTNQNTRWGSCTPSEGSIRLSHR
FT                   LQGMPEYVVDYVLLHELAHLLVPGHGPRFWRLLEAYPRTERARGYLEGVVAADRLPHVP
FT                   GARSE"
     gtgcgcagaa gcgcccggcg acgccggacg gtctccgcgt accgggaggg tgatcgcacc        60
     gtcgtgctga tccccgcccg gatgtccgag gccgaggagc aacgctgggt gagcgtcatg       120
     ctggacaagc tggccgccca ggagagcaag cgcgtcctgg gcgacgccga gctggccgag       180
     cgcgccgagc gcctgtcggg ccagtacttc gagggccggg cccggcccgc ctcggtccgc       240
     tgggtcacca accagaacac ccgctggggc tcgtgcaccc cgtccgaggg aagcatccgg       300
     ctgtcgcacc gcctccaggg catgcccgag tacgtcgtcg actacgtcct cctgcacgag       360
     ctggcgcacc tgctggtccc cgggcacggg ccccggttct ggcggctcct ggaggcgtat       420
     ccgcggaccg agcgagccag gggctacctg gagggtgtgg tcgccgcgga ccggctgccg       480
     cacgttcccg gagcccgcag cgagtaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page