(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5195

AL939122.SCO5195     Location/Qualifiers
FT   CDS_pept        282152..283906
FT                   /transl_table=11
FT                   /gene="SCO5195"
FT                   /gene_synonym="2SC3B6.19"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.19, hypothetical protein, len: 584 aa;
FT                   N-terminal region similar to N-terminal region of TR:Q9RSA4
FT                   (EMBL:AE002055) Deinococcus radiodurans tellurium
FT                   resistance protein TerA DR2223, 400 aa; fasta scores: opt:
FT                   552 z-score: 357.3 E(): 1.9e-12; 40.6% identity in 239 aa
FT                   overlap and C-terminal region similar to TR:Q9RWP1
FT                   (EMBL:AE001920) Deinococcus radiodurans conserved
FT                   hypothetical protein DR0625, 254 aa; blastp scores: Score =
FT                   262 (92.2 bits), Expect = 7.4e-22, P = 7.4e-22, Identities
FT                   = 68/208 (32%), Positives = 117/208 (56%)"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ3"
FT                   /protein_id="CAC01325.1"
FT                   /translation="MAREFQRGHKARISDLTSGTDLYVGVQISGPGLNFDISCFGLDAD
FT                   ERLSDDRYFVFFNQPKTPEESIQLLGAQAGDTESFRVTLDRIPQQIQKLSFTATIDGAG
FT                   QMSQVGPGYIRIVAGGEEVARYPFSGSEFSTERAVMLGDFYLKDVWRFAAVGQGFDGGL
FT                   DALLKNFGGEVAEDEAPAPQQAPQPQAGAAPGFAPPAQAAAPPAFGAPAAPAPAAPAPA
FT                   PVPQPAPQGFAPPPAAPPPPAPVPAPGPDVHAAQTIVAPMNTPPGGAPVPPPAPAPAPY
FT                   GQPGQPGQQPPYGQVLGQTAPPPPGYGQPQAPQAPAPPPGYGQPTAPPGYGQQPGPPAA
FT                   YGQQAPPPGYGQQPPQAMPRGAPQGAGVTAALQQFRETPTGQRWTQQNKKLVRVDLGAE
FT                   GQPVLARQGSMVLYQGKVDFSYKGAGFAGRVVGNATGQEMQLMRCTGKGQVFLAENSAM
FT                   LHPIELQGDAVCVSAENVLAFDESLQYEVRRIEGHGIPGGALFTMQFQGTGTVVVKTRG
FT                   VPVVLPVTPTTFADCNAVVAWSAAAQVVVSSQVRMRRNSYAGDTGESVNLQFRAAPGSF
FT                   VVVQPYEI"
     atggccaggg aatttcaacg cggccacaag gccaggatca gtgacctcac ctcgggcacg        60
     gatctgtacg taggtgtgca gatctccggc cccgggctga acttcgacat cagctgcttc       120
     ggtctcgacg ccgacgagcg gttgtcggac gaccggtact tcgtgttctt caaccaaccg       180
     aagacccccg aggagtccat ccagctcctg ggtgcgcagg cgggtgacac cgagtccttc       240
     cgggtcaccc tcgacaggat cccgcagcag atccagaagc tctccttcac cgcgacgatc       300
     gacggcgcgg gacagatgtc gcaggtgggg cccggataca tccggatcgt cgcgggcggc       360
     gaggaggtgg cccggtaccc gttcagcggt tcggagttct ccaccgagcg cgccgtgatg       420
     ctgggcgact tctacctgaa ggacgtgtgg cgcttcgccg ccgtcgggca gggcttcgac       480
     ggcggtctcg acgcgctgct gaagaacttc ggcggcgagg tggccgagga cgaggccccc       540
     gcaccgcagc aggccccgca gccgcaggcc ggtgccgccc cgggcttcgc cccgcccgcc       600
     caggccgcgg cgccgccggc cttcggcgcg cccgccgccc cggctcccgc ggcccccgcc       660
     ccggctcccg tgccgcagcc cgcaccgcag ggcttcgccc cgccgccggc cgccccgccg       720
     ccaccggctc ccgtcccggc gcccgggccg gacgtgcacg ccgcgcagac catcgtcgcg       780
     cccatgaaca cgccgcccgg cggtgccccg gtgccgcccc ccgccccggc gcccgcgccg       840
     tacggccagc cgggccagcc cggccagcag ccgccctacg gccaggttct cggccagacc       900
     gcaccgccgc cccccggcta cggccagccg caagcccccc aggccccggc cccgccgccc       960
     ggctacggcc agccgaccgc acctcccggt tacggacagc agcccggccc gcccgcggcc      1020
     tacggccagc aggcgccccc gcccggatac gggcagcagc ctccccaggc catgccccgg      1080
     ggtgcgccgc agggcgccgg tgtgaccgct gcgctccagc agttccggga gaccccgacc      1140
     ggccagcgct ggacccagca gaacaagaaa ctggtccgcg tcgacctcgg cgcggaaggc      1200
     cagcccgtcc tcgcccgcca gggcagcatg gtgctctacc agggcaaggt cgacttcagc      1260
     tacaagggcg ccggattcgc cggccgggtc gtgggcaacg ccaccggcca ggagatgcag      1320
     ctgatgcgct gcaccgggaa gggacaggtg ttcctcgcgg agaactccgc gatgctgcac      1380
     cccatcgagc tccagggcga cgccgtctgc gtctccgcgg agaacgtcct ggccttcgac      1440
     gagagcctcc agtacgaggt ccgccgcatc gagggccacg gcatcccggg cggcgcgctg      1500
     ttcacgatgc agttccaggg caccggcacg gtcgtcgtca agacgcgcgg tgtgcccgtg      1560
     gtgctgccgg tgacgcccac gaccttcgcc gactgcaacg ccgtggtcgc ctggtccgcc      1620
     gccgcccagg tggtcgtctc cagccaggtg cggatgcgcc gcaactccta cgcgggcgac      1680
     acgggcgaaa gcgtcaacct gcagttccgg gccgcgcccg gcagcttcgt cgtcgtccag      1740
     ccgtacgaga tctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page