(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5196

AL939122.SCO5196     Location/Qualifiers
FT   CDS_pept        283920..284600
FT                   /transl_table=11
FT                   /gene="SCO5196"
FT                   /gene_synonym="2SC3B6.20"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.20, conserved hypothetical protein, len: 226
FT                   aa; similar to TR:CAB93731 (EMBL:AL357613) Streptomyces
FT                   coelicolor hypothetical 23.8 kD protein SC5F8.03c, 225 aa;
FT                   fasta scores: opt: 439 z-score: 523.3 E(): 1.1e-21; 37.8%
FT                   identity in 222 aa overlap"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ2"
FT                   /protein_id="CAC01326.1"
FT                   /translation="MNQPLAGYAPAPAGARMENHGNHMLKVAMQTGNDLLARVGSMTAY
FT                   EGFVQYEPNPPAVRQIAKDWMTGEGAPLMKCSGDGLLYLADYGANVVVINLNGDGISVN
FT                   ATNLLAFDAHLTWGVERVKGLAKFAGQGLWNTKISGQGWVALTSRGKPIVVDCGGGEDE
FT                   TYVDPDALVAWSPNLKVKGKRSFKAQSLIGRGSGEAFQMAFSGQGIVVVQPSEDSTDRL
FT                   RVRG"
     atgaaccagc cgctcgcggg ctacgccccc gctcctgccg gcgcccgcat ggagaaccac        60
     ggcaaccaca tgctgaaggt cgccatgcag accggaaacg acctcctcgc gcgcgtgggc       120
     tcgatgaccg cctacgaggg cttcgtccag tacgagccga acccgccggc cgtccgccag       180
     atcgccaagg actggatgac cggtgagggc gcgcccctga tgaagtgctc cggcgacggg       240
     ctgctctacc tcgccgacta cggtgccaac gtcgtcgtga tcaacctcaa cggcgacggg       300
     atctccgtca acgccaccaa cctgctcgcc ttcgacgccc acctgacgtg gggcgtggag       360
     cgcgtcaagg gcctggcgaa attcgccggg cagggcctgt ggaacacgaa gatctccggg       420
     cagggctggg tcgcgctcac ctcccggggc aagccgatcg tggtcgactg cggcggcggc       480
     gaggacgaga cctacgtcga cccggacgcg ctcgtggcct ggtccccgaa cctcaaggtg       540
     aagggcaagc gcagcttcaa ggcgcagtcg ctgatcggcc gcggcagcgg cgaggccttc       600
     cagatggcct tctccggtca gggcatcgtc gtcgtccagc ccagcgagga cagcaccgac       660
     cgcctccggg tccggggctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page