(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5197

AL939122.SCO5197     Location/Qualifiers
FT   CDS_pept        284618..285373
FT                   /transl_table=11
FT                   /gene="SCO5197"
FT                   /gene_synonym="2SC3B6.21"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.21, conserved hypothetical protein, len: 251
FT                   aa; similar to TR:CAB93731 (EMBL:AL357613) Streptomyces
FT                   coelicolor hypothetical 23.8 kD protein SC5F8.03c, 225 aa;
FT                   fasta scores: opt: 449 z-score: 539.1 E(): 1.5e-22; 35.7%
FT                   identity in 230 aa overlap"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ1"
FT                   /protein_id="CAC01327.1"
FT                   /translation="MQSPIFAYNDQQTQEAWSLQNKHMLRVALTGHDDVLARKGTMVAY
FT                   QGLVEFDAEYQSNSQSRSRAHTGEGLDLMRCHGQGTVYFSNLAQCVHVVDVDQDGLTVD
FT                   SSYVLAMDSNLHHEVIAVDSLYGISGSGKYQLNITGRGKVALMTSGSPLFMQVTPDKYV
FT                   NCDADAIVAWSTGLRVQMQAQTHSSGVWRRRGNTGEGWELSFMGSGFALVQPSELLPPQ
FT                   NAQVGQGLAAQYGMGQHGARGQSQGNVWS"
     atgcagagcc cgattttcgc ctacaacgac cagcagaccc aggaagcctg gagcctgcag        60
     aacaagcaca tgctccgtgt cgccctgacg ggccacgacg acgtgctcgc ccgcaagggc       120
     acgatggtcg cctaccaggg gctcgtcgag ttcgacgccg agtaccagag caacagccag       180
     tcgcgctcgc gtgcgcacac cggcgagggc ctggacctga tgcgctgcca cgggcagggc       240
     acggtctact tctccaacct cgcccagtgc gtccacgtcg tggacgtcga ccaggacggc       300
     ctcaccgtcg acagcagcta cgtgctcgcg atggactcga acctgcacca cgaggtcatc       360
     gcggtggaca gcctctacgg catctccggc tcggggaagt accagctcaa catcacgggc       420
     cgcggaaagg tcgccctgat gacctcgggc tcgccgctgt tcatgcaggt gacacccgac       480
     aagtacgtca actgcgacgc cgacgcgatc gtggcctggt ccaccggtct gcgcgtgcag       540
     atgcaggccc agacgcactc ctccggggtg tggcggcgcc gcgggaacac cggtgagggc       600
     tgggagctga gcttcatggg cagcggcttc gcgctcgtcc agcccagcga gctgctgccg       660
     ccgcagaacg cccaggtcgg gcagggcctc gccgcgcagt acggcatggg gcagcacggg       720
     gcccgcggtc agagccaggg caacgtctgg agctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page