(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5199

AL939122.SCO5199     Location/Qualifiers
FT   CDS_pept        complement(285945..287408)
FT                   /transl_table=11
FT                   /gene="SCO5199"
FT                   /gene_synonym="2SC3B6.23c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.23c, conserved hypothetical protein, len: 487
FT                   aa; similar to TR:O53341 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 49.4 kD protein, 472 aa; fasta
FT                   scores: opt: 1382 z-score: 1331.8 E(): 0; 46.2% identity in
FT                   489 aa overlap"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI9"
FT                   /protein_id="CAC01329.1"
FT                   /translation="MSDTPFGFGLPPEEPDDGDEGKKKDQQSGGGQGPANPFGFGMSGA
FT                   GGLGGPGADNPFAAMFGSMNPNDLGAAFQQLGQMLSYEGGPVNWDMAKQIARQTVSQGT
FT                   PDGRKDASVGPAERNAVQEAVRLADLWLDDATALPSGAGTAVAWSRAEWVEATLPAWRE
FT                   LVDPVAERVGNAMGDVLPEEMQAMAGPLIGMMRSMGGAMFGTQIGQAVGVLAGEVVGST
FT                   DVGLPLGPAGKAALLPANIESFGKDLGVPQEEVRLYLALREAAHQRLFAHVPWLRSHLF
FT                   GAVDGYARGIKVDTAKLEDVVGQFDPQNPEQLQEALQQGMFQPEDTPEQKAALARLETA
FT                   LALVEGWVDAVVHTAAKPRLSSADALRETLRRRRASGGPAEQTFATLIGLELRPRRLRD
FT                   ASRLWASLTDAHGVDGRDGLWAHPDMLPTATDLDDPDGFVHREQLDFSELDKMLGEAAG
FT                   KPDLKKKDEGDRGENRSADRDEPKGDDGE"
     gtgagtgaca ccccattcgg attcggcctt ccgccggagg agccggacga cggcgacgag        60
     ggcaagaaga aggaccagca gagcggcggt ggtcagggac cggccaaccc gttcggtttc       120
     gggatgtccg gagccggagg cctgggcggc cccggcgcgg acaacccgtt cgctgccatg       180
     ttcggttcca tgaaccccaa cgacctgggc gccgcgttcc agcagctggg ccagatgctc       240
     tcctacgagg gcggcccggt gaactgggac atggccaagc agatcgcccg gcagacggtc       300
     tcccagggca cgccggacgg ccgcaaggac gccagcgtcg gtcccgccga gcgcaatgcc       360
     gtccaggagg cggtgcgtct ggccgatctg tggctggacg acgcgacggc cctgccgtcg       420
     ggcgcgggta ccgccgtggc ctggagccgc gcggagtggg tcgaggcgac cctgcccgcg       480
     tggcgcgagc tggtcgaccc ggtcgccgag cgcgtcggca acgccatggg cgacgtgctg       540
     ccggaggaga tgcaggccat ggccggcccg ctgatcggca tgatgcggtc catgggcggc       600
     gccatgttcg gcacgcagat cgggcaggcc gtcggcgtgc tcgccggcga ggtcgtcggc       660
     tcgaccgacg tgggtctgcc gctcggcccg gcgggcaagg ccgcgctgct gccggcgaac       720
     atcgagtcgt tcggcaagga cctcggcgtg ccccaggagg aggtgcggct gtacctggcg       780
     ctgcgcgagg ccgcccacca gcgcctcttc gcgcacgtgc cgtggctgcg ctcgcacctg       840
     ttcggtgccg tcgacggcta cgcccgtggg atcaaggtcg acacggccaa gctggaggac       900
     gtggtcggcc agttcgaccc gcagaacccc gagcagctgc aggaggctct ccagcagggc       960
     atgttccagc cggaggacac gccggagcag aaggcggccc tggcccggct ggagaccgct      1020
     ctcgcgctcg tcgagggctg ggtggacgcg gtggtgcaca ccgccgcgaa gccgcgcctg      1080
     tcctccgccg acgcgctgcg cgagacgctg cgccgccgtc gcgcctcggg cggtcccgcc      1140
     gagcagacgt tcgcgacgct gatcggtctc gagctgcgcc cgcgccggct gcgcgacgcc      1200
     tcccgcctgt gggcgtccct gacggacgcg cacggtgtcg acggccggga cgggctgtgg      1260
     gcccacccgg acatgctgcc gaccgcgacc gacctggacg acccggacgg cttcgtgcac      1320
     cgtgagcagc tcgacttctc cgagctggac aagatgctcg gcgaggcggc gggcaagccc      1380
     gatctgaaga agaaggacga gggcgaccgg ggcgagaacc ggtccgccga ccgggacgag      1440
     cccaagggcg acgacggcga gtga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page