(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5201

AL939122.SCO5201     Location/Qualifiers
FT   CDS_pept        288833..289291
FT                   /transl_table=11
FT                   /gene="SCO5201"
FT                   /gene_synonym="2SC3B6.25"
FT                   /product="moaE-like protein"
FT                   /note="2SC3B6.25, moaE-like protein, len: 152 aa; similar
FT                   to SW:MOAE_ECOLI (EMBL:X70420) Escherichia coli
FT                   molybdopterin [mpt] converting factor, subunit 2 MoaE, 149
FT                   aa; fasta scores: opt: 255 z-score: 317.2 E(): 3.3e-10;
FT                   33.3% identity in 129 aa overlap"
FT                   /db_xref="GOA:Q9FCI7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI7"
FT                   /protein_id="CAC01331.1"
FT                   /translation="MATTNDHPGERAAADPVKLIGIRETPLSVDEVFGAVGDDASGGTA
FT                   LFVGTVRNHDGGTDVDRLGYSCHPSAEAEMRRIAEKVVAEYPVRALAALHRVGDLEVGD
FT                   LAVVVAVSCPHRGEAFDACRKLIDDLKHEVPIWKHQTFSDGTEEWVGA"
     atggcaacca cgaacgacca ccccggcgag cgggccgcag cggaccccgt gaagctgatc        60
     ggcatccgtg agacgcccct gtccgtggac gaggtcttcg gcgcggtcgg ggacgacgcg       120
     tcgggcggca ccgcgctgtt cgtggggacc gtgcgcaacc acgacggcgg caccgacgtc       180
     gaccggctcg ggtactcgtg ccacccgagc gccgaggcgg agatgcgccg gatcgcggag       240
     aaggtcgtcg cggagtaccc cgtacgggcg ctcgcggcac tgcaccgtgt gggtgacctg       300
     gaggtcgggg acctcgcggt ggtcgtcgcc gtgtcctgtc cgcaccgggg cgaggccttc       360
     gacgcctgcc gcaagctgat cgacgacctc aagcacgagg tgcccatctg gaagcaccag       420
     acgttctccg acggaaccga ggaatgggtg ggcgcgtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page