(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5202

AL939122.SCO5202     Location/Qualifiers
FT   CDS_pept        289650..290744
FT                   /transl_table=11
FT                   /gene="SCO5202"
FT                   /gene_synonym="2SC3B6.26"
FT                   /product="putative secreted protein"
FT                   /note="2SC3B6.26, possible secreted protein, len: 364 aa;
FT                   similar to TR:O53340 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 35.5. kD protein, 340 aa; fasta
FT                   scores: opt: 430 z-score: 467.4 E(): 1.4e-18; 41.3%
FT                   identity in 361 aa overlap. Contains possible N-terminal
FT                   signal peptide sequence"
FT                   /db_xref="GOA:Q9FCI6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI6"
FT                   /protein_id="CAC01332.1"
FT                   /translation="MPRRTATMLASTLMLIALLCAGVFIPVPYSEMSPGPTVNTLGDHD
FT                   GEPVLQISGHKTYEASGHLNMTTVRVTSAEYRMNLVEAVYGWLAHDNSVVPHETLYPDG
FT                   KTEEEATQENAEEFSQSQESAKVAALKALDIPVKSWVVVSAVVKDSPSQGRLHAGDVIK
FT                   AVDGTTVKKPADVAELVTKHEPGQDTVFTIVPAKEQAAAEKEGRTATKTQKITIRTETS
FT                   QDAGAQRAVVGISAGTDHTFPFEIDIKLADVGGPSAGLMFALGIYDKLTPGDLTGGKFV
FT                   AGTGTIDDNGKVGPIGGIGMKTIGAHDKGAQYFLTPADNCAAAAEDTPDGLTLVKVDTI
FT                   DDALGALKDIRSGKTADLPKCTQG"
     atgccacgcc gcaccgcgac gatgctcgcc tccaccctga tgctgatcgc gctcctgtgc        60
     gcgggtgttt tcatccccgt gccgtactcg gagatgtcgc ccgggccgac ggtgaacacc       120
     ctcggggacc acgacggcga gccggtgctc cagatctccg gtcacaagac ctacgaggcg       180
     agcggtcatc tgaacatgac caccgtccgg gtcaccagcg ccgagtaccg gatgaacctc       240
     gtggaggccg tctacggctg gctggcacac gacaacagcg tggtgccgca cgagaccctc       300
     tacccggacg gcaagaccga ggaagaggcc acccaggaga acgccgagga gttcagccag       360
     tcccaggaga gcgcgaaggt cgccgctctg aaggcgctcg acatcccggt gaagtcctgg       420
     gtggtcgtct ccgccgtcgt caaggactcc ccgtcgcagg gccggctgca cgccggcgac       480
     gtgatcaagg ccgtggacgg cacgaccgtc aagaagcccg cggacgtcgc cgagctggtg       540
     accaagcacg agccgggaca ggacaccgtc ttcacgatcg tgcccgccaa ggagcaggcc       600
     gccgcggaga aggagggccg gacggcgacg aagacccaga agatcaccat caggaccgag       660
     acctcccagg acgcgggcgc gcagcgcgcc gtcgtaggga tctccgccgg aacggaccac       720
     acgttcccgt tcgagatcga catcaagctg gccgacgtcg gcggcccgag cgccggtctg       780
     atgttcgccc tcggcatcta cgacaagctc acccccggcg acctcaccgg cggcaagttc       840
     gtcgccggca ccgggacgat cgacgacaac ggcaaggtcg gcccgatcgg cggcatcggc       900
     atgaagacca tcggcgcgca cgacaagggc gcccagtact tcctgacgcc cgcggacaac       960
     tgcgcggcgg ccgccgagga cacccccgac gggctcaccc tcgtgaaggt ggacaccatc      1020
     gacgacgccc tcggcgcgct caaggacatc cgttccggaa agaccgccga cctgccgaag      1080
     tgcacgcagg ggtag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page