(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5205

AL939122.SCO5205     Location/Qualifiers
FT   CDS_pept        294876..296699
FT                   /transl_table=11
FT                   /gene="SCO5205"
FT                   /gene_synonym="SC7E4.02"
FT                   /product="hypothetical protein SC7E4.02"
FT                   /note="SC7E4.02, hypothetical protein, len: 607 aa; similar
FT                   to TR:CAB83499 (EMBL:AL162752) Neisseria meningitidis
FT                   hypothetical 51.6 kD protein NMA0184, 468 aa; fasta scores:
FT                   opt: 268 z-score: 307.6 E(): 1.2e-09; 29.5% identity in 528
FT                   aa overlap"
FT                   /db_xref="GOA:Q9K4B3"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B3"
FT                   /protein_id="CAB94590.1"
FT                   /translation="MGDMANLFGTGRFAQPSGQLSGQEEATDEAQEAADEAAEEVRLRL
FT                   AVDCGDVEAMSVLGAMLLRRGDFDAAESHLRAATAAGDRAAANNLGVLLHQRGYADEAA
FT                   GWWRIAAVAGSAAAAHALGRHFRERGDEPAAEYWLCQSAEQGHVLGAYALADLLEHRGD
FT                   DTGSERWMRAAAERGHREAAYRLARTLDRRAGRDGDDKAAARAADEAEQWYRQAAARGH
FT                   RRGALHLGTILEKRGELKEAGRWYLTSAKDGEARAACALGFLLRDAGDTESAAVWWLRA
FT                   AQDGDGNAANALGALHAERGETQTAERWYRAAMDAGDDNGAYNLGLLCAEQGRTTQAEQ
FT                   WYRRAAYAGHREASNALAILLLRAGDESGAEPWFSKAAEAGSVDAAFNLGILHAGRSEE
FT                   RAALRWYERAAAAGHTEAALQVGMARLRGGDEQEAERFLRCAAGGGSAEAAYRLATVLD
FT                   ARRPPEPAHELGEPAQDKSECEEWYERAASQGHRRAQVRVGMLAAARGDVVEAARWYRE
FT                   AAEAGSRNGAFNLGLLLAREGSEPEAVVWWRRAADAGHGRAALRLALVCARRGELAEGQ
FT                   RWADLAVSLGPREVGERAARLRDALRQELSA"
     atgggggaca tggcaaatct gttcgggaca gggcgttttg cgcagccttc cggtcagctt        60
     tccggtcagg aggaggccac ggacgaggct caggaagccg ccgacgaggc cgccgaggaa       120
     gtgcgcctgc ggctcgccgt cgactgtggt gacgtcgagg cgatgagcgt gctcggcgcg       180
     atgctgctgc gccgtggcga cttcgacgca gccgagtcgc acctgcgtgc cgccaccgcg       240
     gccggcgacc gggccgccgc caacaacctg ggcgtcctgc tgcaccagcg gggatacgcc       300
     gacgaggccg ccggctggtg gcgcatcgcc gccgtcgccg gatccgccgc cgccgcgcac       360
     gcgctcggcc ggcacttccg ggaacgcggg gacgagcccg ccgccgagta ctggctgtgc       420
     cagtccgcgg aacaggggca cgtgctgggc gcctacgcgc tcgccgacct gctggagcac       480
     cgcggcgacg acaccgggtc cgagcggtgg atgcgggccg cggccgaacg cgggcaccgg       540
     gaagcggcgt accggctggc gcggacgctg gaccggcggg ccgggcggga cggcgacgac       600
     aaggccgccg cacgcgcggc cgacgaggcc gagcagtggt accggcaggc cgccgcgcgc       660
     ggtcaccggc gcggcgcgct gcacctgggg acgatcctgg agaagcgcgg cgagctcaag       720
     gaggcgggcc gctggtacct cacgtccgcc aaggacggcg aggcccgcgc cgcctgcgcg       780
     ctcggcttcc tgctgcggga cgccggggac accgagagcg ccgccgtgtg gtggctgcgc       840
     gccgcccagg acggcgacgg caacgccgcc aacgccctgg gcgcgctgca cgccgagcgc       900
     ggcgagaccc agaccgcgga gcgctggtac cgggccgcga tggacgcggg cgacgacaac       960
     ggggcgtaca acctcgggct gctctgcgcc gagcagggcc gcaccacgca ggccgagcag      1020
     tggtaccgga gggccgccta cgccgggcac cgggaggcct ccaacgcgct ggccatcctg      1080
     ctgctgcgcg ccggggacga gagcggcgcc gagccgtggt tctccaaggc cgccgaggcg      1140
     ggcagcgtcg acgccgcctt caacctcggg atcctgcacg ccgggcggag cgaggagcgg      1200
     gcggcgctgc gctggtacga gcgggccgcc gccgccgggc acaccgaggc ggcgctccag      1260
     gtcgggatgg cgcggctgcg cggcggggac gagcaagagg cggagcggtt cctgcgctgt      1320
     gcggccgggg gcggcagcgc ggaggccgcg taccggctgg cgacggtgct ggacgcgcgc      1380
     cggccgccgg agcccgcgca cgagctgggt gagcccgcgc aggacaagtc cgagtgcgag      1440
     gagtggtacg agcgggccgc ctcccagggg caccggcgcg cgcaggtgcg ggtcgggatg      1500
     ctcgccgcgg cgcggggcga cgtggtggag gccgcgcggt ggtaccgcga ggcggccgag      1560
     gccgggtccc gcaacggtgc gttcaacctg gggctgctgc tggcccgcga agggagcgag      1620
     cccgaggccg tcgtgtggtg gcgcagggcg gccgacgccg ggcacgggcg ggcggcgctg      1680
     cggctggcgc tggtctgtgc gcggcggggg gagctggcgg aggggcagcg gtgggcggac      1740
     ctcgcggtgt cactggggcc gcgggaggtg ggggagcggg cggctcggct gcgggacgcg      1800
     ttgcggcagg agctgtcggc gtga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page