(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5208

AL939122.SCO5208     Location/Qualifiers
FT   CDS_pept        complement(298087..298887)
FT                   /transl_table=11
FT                   /gene="SCO5208"
FT                   /gene_synonym="SC7E4.05c"
FT                   /product="putative monophosphatase"
FT                   /note="SC7E4.05c, probable monophosphatase, len: 266 aa;
FT                   similar to SW:STRO_STRGR (EMBL:Y08763) Streptomyces griseus
FT                   glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)
FT                   StrO, 259 aa; fasta scores: opt: 316 z-score: 395.8 E():
FT                   1.4e-14; 35.9% identity in 248 aa overlap. Contains 2x Pfam
FT                   match to entry PF00459 inositol_P, Inositol monophosphatase
FT                   family and match to Prosite entry PS00629 Inositol
FT                   monophosphatase family signature 1"
FT                   /db_xref="GOA:Q9K4B1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4B1"
FT                   /protein_id="CAB94593.1"
FT                   /translation="MPDYLDDLRLAHVLADAADAATMDRFKALDLKVETKPDMTPVSEA
FT                   DKAAEELIRGHLSRARPRDSVHGEEFGVAGTGPRRWVIDPIDGTKNYVRGVPVWATLIA
FT                   LMEAKEGGYQPVVGLVSAPALGRRWWAVEDHGAFTGRSLTSAHRLHVSQVSTLSDASFA
FT                   YSSLSGWEEQGRLDGFLDLTREVWRTRAYGDFWPYMMVAEGSVDLCAEPELSLWDMAAN
FT                   AIIVTEAGGTFTGLDGRPGPHSGNAAASNGRLHDELLGYLNQRY"
     atgcccgatt acctcgacga cctccgcctc gcccacgtgc tcgccgacgc cgccgacgcc        60
     gcgacgatgg accgcttcaa ggccctcgat ctgaaggtcg agacgaagcc ggacatgacc       120
     ccggtgagcg aggcggacaa ggccgccgag gaactcatcc gcggtcacct ctcccgcgcc       180
     cgcccccgcg actcggtcca cggcgaggag ttcggcgtgg cgggcaccgg cccgcggcgc       240
     tgggtcatcg acccgatcga cggcaccaag aactacgtgc gcggtgtccc cgtctgggcc       300
     accctcatcg ccctgatgga ggcgaaggag ggcggctacc agccggtcgt cggcctcgtc       360
     tcggcgcccg ccctcggccg ccgctggtgg gcggtggagg accacggcgc gttcaccggc       420
     cgcagcctga cctccgccca tcggctccac gtctcccagg tctccacgct ctccgacgcc       480
     tccttcgcgt actcctcgct gagcggctgg gaggagcagg gccgcctcga cggcttcctg       540
     gacctgaccc gcgaggtgtg gcgcacgcgc gcgtacggcg acttctggcc gtacatgatg       600
     gtcgccgagg gctcggtgga cctctgcgcc gaaccggagc tctccctctg ggacatggcc       660
     gcgaacgcga tcatcgtcac ggaggccggc ggcaccttca ccggcctcga cggccgcccc       720
     ggcccgcaca gcggcaacgc ggcggcgtcg aacggccggc tccacgacga actgctcggg       780
     tatctcaacc agcgctactg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page