(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5209

AL939122.SCO5209     Location/Qualifiers
FT   CDS_pept        299080..299691
FT                   /transl_table=11
FT                   /gene="SCO5209"
FT                   /gene_synonym="SC7E4.06"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SC7E4.06, possible tetR-family transcriptional
FT                   regulator, len: 203 aa; similar to TR:Q9Z551
FT                   (EMBL:AL035212) Streptomyces coelicolor putative
FT                   transcriptional regulator SC9B2.08c, 192 aa; fasta scores:
FT                   opt: 169 z-score: 206.9 E(): 0.00047; 31.9% identity in 182
FT                   aa overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 24..45 (+3.85 SD)"
FT                   /db_xref="GOA:Q9K4B0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B0"
FT                   /protein_id="CAB94594.1"
FT                   /translation="MPAARESLLDAAYTALARRPWSAVRMVDVAASAGVSRQTLYNEFG
FT                   SKEGLARALVRREADGYLAGVERALSGPSDPRERLTATAEWMMSAARDNALVRAMLTGC
FT                   WNERLPAPALTAVPSSCAVPAQRRADGPLPSPGDFVGLVRDRAVAVLGGAGPLPPPDAA
FT                   ELARSCELTVRLALSCVAAPPAEGGVADLVRTALPRRLTA"
     gtgcccgcag cccgggagtc cctgctcgac gccgcgtaca cggcgctggc gcgccggccg        60
     tggtccgccg tgcggatggt ggacgtggcg gcttccgccg gggtgtcccg gcagaccctc       120
     tacaacgagt tcggcagcaa ggagggactc gcccgggccc tggtgaggcg ggaggccgac       180
     ggctacctcg ccggagtgga gcgcgcgctc tccgggccca gcgacccgcg tgaacgactc       240
     accgccaccg ccgagtggat gatgtcggcg gcccgcgaca acgcgctggt ccgggccatg       300
     ctcacggggt gctggaacga gcggctgccc gcaccggccc tgacggcggt gccctcctcc       360
     tgcgcggtgc cggcccagcg acgggccgac ggtccactgc cctcgcccgg cgacttcgtg       420
     ggcctggtcc gcgaccgtgc cgtggccgtc ctgggcgggg ccgggccgct cccgccgccg       480
     gacgccgccg aactggcccg ctcctgcgaa ctgaccgtgc gcctcgccct ctcctgcgtc       540
     gccgcgccgc ccgccgaggg cggggtggcc gacctcgtac gcaccgccct gccacgccgc       600
     ctgacggcat ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page