(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5210

AL939122.SCO5210     Location/Qualifiers
FT   CDS_pept        complement(299723..300046)
FT                   /transl_table=11
FT                   /gene="SCO5210"
FT                   /gene_synonym="SC7E4.07c"
FT                   /product="putative molecular chaperone"
FT                   /note="SC7E4.07c, possible molecular chaperone, len: 107
FT                   aa; similar to SW:SUGE_ECOLI (EMBL:X69949) Escherichia coli
FT                   SugE protein, 105 aa; fasta scores: opt: 341 z-score: 449.1
FT                   E(): 1.5e-17; 44.7% identity in 103 aa overlap and to
FT                   TR:CAB88839 (EMBL:AL353832) Streptomyces coelicolor sugE,
FT                   SCE6.35c, 106 aa; fasta scores: opt: 323 z-score: 386.5
FT                   E(): 6e-16; 43.0% identity in 107 aa overlap. Contains Pfam
FT                   match to entry PF00893 DUF7, Integral membrane protein and
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A9"
FT                   /protein_id="CAB94595.1"
FT                   /translation="MAWLLVIVAGVLETGFAVCLKLSHGFTRLWPTIAFCAFALGSFGL
FT                   LTMSLKKLDVGPAYAVWTGIGAAGTAIYGMIFLGDLVSTLKIVSISFVIIGVIGLQLSG
FT                   SAH"
     atggcgtggc tgctggtcat agtggccgga gtgctcgaaa ccggcttcgc cgtctgtctg        60
     aagctgtcgc acggcttcac ccggctctgg cccaccatcg ccttctgcgc cttcgcgctg       120
     ggcagcttcg gcctgctgac gatgtccctg aagaagctcg acgtcggccc cgcgtacgcg       180
     gtgtggaccg gcatcggcgc ggcgggtacc gccatctacg gcatgatctt cctcggcgac       240
     ctggtctcga ccctgaagat cgtctcgatc agcttcgtca tcatcggcgt gatcggtctg       300
     cagctgtcgg gctcggcgca ctag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page