(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5211

AL939122.SCO5211     Location/Qualifiers
FT   CDS_pept        complement(300249..301262)
FT                   /transl_table=11
FT                   /gene="SCO5211"
FT                   /gene_synonym="SC7E4.08c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC7E4.08c, conserved hypothetical protein, len: 337
FT                   aa; similar to TR:O05873 (EMBL:Z95121) Mycobacterium
FT                   tuberculosis hypothetical 34.9 kD protein MTCY20B11.03, 330
FT                   aa; fasta scores: opt: 1051 z-score: 1176.2 E(): 0; 52.7%
FT                   identity in 338 aa overlap. Contains match to Prosite
FT                   entryPS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9K4A8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A8"
FT                   /protein_id="CAB94596.1"
FT                   /translation="MRRYGKHTDEDDIRSRPNRKGNRPRTHIRPKHEDAAEGLVLTVDR
FT                   GRLTCLVDDRVVMAMKARELGRKAAIVGDRVALVGDLTGKKDTLARIVRIEERTSVLRR
FT                   TADDDDPYERVVVANADQLAIVTALADPEPRPRLIDRCLVAAFDGGLTPLLVMTKSDLA
FT                   PPDELLELYGALDIPYVVTSREELENGAAADLVREHLDGKITAFVGHSGVGKTTLVNTL
FT                   VPEDRRRVTGHVNAVTGRGRHTTTSALALPLSSAAGGWVVDTPGVRSFGLAHIDPSRVI
FT                   NAFPDLVPGTEGCPRACSHDEPDCALDAWVAEGHADPARLYSLRRLLSTRERKEGD"
     atgcgccgct acggcaagca caccgacgag gacgacatcc gctcccgccc caaccgcaag        60
     ggcaaccgac cgcgcaccca catccggccc aagcacgagg acgccgccga gggcctggtc       120
     ctcaccgtgg accgcggccg gctgacctgc ctcgtcgacg accgggtcgt catggcgatg       180
     aaggcgcgcg agctgggccg caaggcggcg atcgtgggtg accgggtggc cctggtcggc       240
     gacctcaccg gcaagaagga cacgctcgca cgcatcgtcc gcatcgagga gcgcacctcg       300
     gtcctgcgcc gcacggccga cgacgacgac ccctacgagc gggtcgtcgt cgccaacgcc       360
     gaccagctcg ccatcgtcac cgccctcgcc gaccccgagc cgcgcccccg cctcatcgac       420
     cgctgcctgg tcgcggcgtt cgacggcggc ctcaccccgc tgctggtgat gaccaagtcg       480
     gacctggcac cgccggacga actcctcgag ctgtacggcg cgttggacat cccgtacgtc       540
     gtcaccagcc gggaggagct ggagaacggc gccgccgccg acctggtgcg cgagcacctg       600
     gacgggaaga tcacggcctt cgtcggccac tccggcgtcg gcaagacgac cctggtcaac       660
     accctggtgc ccgaggaccg ccgccgggtg acggggcacg tcaacgcggt gacggggcgc       720
     ggccggcaca ccacgacctc ggccctcgcc ctgccgctgt cctccgcggc gggcggctgg       780
     gtcgtcgaca ccccgggcgt acggtcgttc gggctggcgc acatcgatcc gtcccgggtg       840
     atcaacgcct tccccgacct ggtgcccggc accgagggct gtccgcgggc gtgcagccac       900
     gacgagcccg actgcgcgct ggacgcctgg gtcgccgagg ggcacgccga cccggcccgg       960
     ctgtactcgc tgcgccggct gctgtcgacg cgggaacgca aggaaggcga ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page