(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5212

AL939122.SCO5212     Location/Qualifiers
FT   CDS_pept        complement(301275..302591)
FT                   /transl_table=11
FT                   /gene="SCO5212"
FT                   /gene_synonym="aroA2"
FT                   /gene_synonym="SC7E4.09c"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="SC7E4.09c, aroA2, 3-phosphoshikimate
FT                   1-carboxyvinyltransferase, len: 438 aa; highly similar to
FT                   SW:AROA_MYCTU (EMBL:X52269) Mycobacterium tuberculosis
FT                   3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)
FT                   AroA, 450 aa; fasta scores: opt: 1236 z-score: 1339.4 E():
FT                   0; 52.1% identity in 434 aa overlap and similar to
FT                   TR:CAB71266 (EMBL:AL138598) Streptomyces coelicolor
FT                   SC1A2.28c AroA, 440a aa; fasta scores: opt: 731 z-score:
FT                   673.3 E(): 6.4e-32; 36.3% identity in 413 aa overlap.
FT                   Contains Pfam match to entry PF00275 EPSP_syntase, EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="GOA:Q9K4A7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4A7"
FT                   /protein_id="CAB94597.1"
FT                   /translation="MTVNPTHTALWPAPHASGAVDATVHVPGSKSVTNRALVLAALASE
FT                   PGWLRRPLRSRDTLLMAEALRTLGVEIEEGVGPEGTGEFWRVIPAGLRGPATVDVGNAG
FT                   TVMRFLPPVATLADGAVRFDGDPRSYERPLHGVIDALRVLGARIDDDGRGALPLTVHGG
FT                   GALEGGPVEIDASSSSQFVSALLLSGPRFNQGVEVRHTGSALPSMPHIRMTVDMLRAVG
FT                   AQVDTPESGGEPNVWRVTPGALLGRDLTVEPDLSNAQPFLAAALVTGGKVVIPDWPSRT
FT                   TQPGDRLREIFTDMGGSCELTDFGLVFTGSGAIHGIDVDLSEVGELTPGIAAVAALADS
FT                   PSTLRGVAHLRLHETDRLAALTKEINELGGDVTETADGLHIRPRRLHGGVFHTYDDHRM
FT                   ATAGAVLGLAVEGVQIENVATTAKTLPDFPDLWTGMLGA"
     atgaccgtga accccacgca caccgccctc tggcccgccc cgcacgcgag cggagccgtc        60
     gacgcgaccg tccacgtgcc cgggtccaag tcggtcacca accgcgccct ggtgctggcc       120
     gccctcgcct ccgagcccgg ctggctgcgc cgcccgctgc gctcccgcga caccctgctg       180
     atggccgagg cgctgcgcac gctgggcgtc gagatcgagg agggcgtcgg ccccgagggc       240
     accggcgagt tctggcgggt catcccggcg gggctgcgcg gcccggccac ggtcgacgtc       300
     ggcaacgccg gcacggtcat gcgcttcctg ccgccggtcg ccacgctggc cgacggcgcc       360
     gtccgtttcg acggcgaccc gcggtcgtac gagcgtccgc tgcacggcgt gatcgacgcg       420
     ctgcgcgtcc tgggcgcccg catcgacgac gacgggcgcg gcgcgctgcc gctgaccgtg       480
     cacggcggcg gggccctgga gggcggcccg gtcgagatcg acgcgtcctc ctcctcccag       540
     ttcgtcagcg ccctgctgct gtccgggccg cgcttcaacc agggcgtcga ggtgcgccac       600
     accggttccg cgctgccctc catgccgcac atccgcatga cggtcgacat gctgcgcgcg       660
     gtcggcgccc aggtcgacac ccccgagtcc ggcggcgagc cgaacgtgtg gcgggtcacg       720
     ccgggtgcgc tgctcggccg ggacctgacc gtcgagccgg acctgtcgaa cgcgcagccg       780
     ttcctggcgg cggcgctggt gaccggcggc aaggtggtga tccccgactg gccgtcccgc       840
     accacccagc ccggcgaccg gctgcgcgag atcttcaccg acatgggcgg ttcctgcgaa       900
     ctgacggact tcggactcgt gttcaccgga tcgggtgcga tccacggcat cgacgtcgac       960
     ctgagcgagg tcggcgagct gaccccgggg atcgcggccg tcgccgccct cgcggactcc      1020
     ccctcgaccc tgcgcggcgt ggcccatctg cggctgcacg agacggaccg gctggccgcg      1080
     ctcaccaagg agatcaacga actcggcggt gacgtcaccg agaccgccga cggtctgcac      1140
     atccgcccgc gccgtctgca cggcggcgtc ttccacacct acgacgacca ccgcatggcc      1200
     accgccggcg ccgttctcgg tctcgcggtg gagggcgtgc agatcgagaa cgtggcgacg      1260
     accgccaaga ccctgcccga cttccccgac ctgtggaccg ggatgctcgg ggcgtag         1317
//

If you have problems or comments...

PBIL Back to PBIL home page