(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5213

AL939122.SCO5213     Location/Qualifiers
FT   CDS_pept        complement(302715..303437)
FT                   /transl_table=11
FT                   /gene="SCO5213"
FT                   /gene_synonym="SC7E4.10c"
FT                   /product="putative integral membrane protein"
FT                   /note="SC7E4.10c, possible integral membrane protein, len:
FT                   240 aa; similar to TR:CAB89063 (EMBL:AL353872) Streptomyces
FT                   coelicolor putative integral membrane protein SC5G8.12, 322
FT                   aa; fasta scores: opt: 126 z-score: 158.5 E(): 0.23; 25.6%
FT                   identity in 160 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A6"
FT                   /protein_id="CAB94598.1"
FT                   /translation="MDHLATASLTSLWDEVSGIQPDPDLWVVVATLVAALAVVATRGSW
FT                   RIARNAITIAHEGGHGLVALLTGRTLTGITLHSDTSGLTVSRGKPHGVGMILTAVAGYT
FT                   APPLLGLGGAALLAAGRITLLLWLATALLVALLVMVRNAYGVLTVVVTGGTFVLVSWLA
FT                   GPQVQAAFAYAVVWFLLLGGVRPAFELQAKRSRGGAGDSDADQLARLTHAPAGVWFFLF
FT                   HAVSLCSLIGGARWLLEL"
     atggaccacc tcgcaacggc ctcgctcacc tccctgtggg acgaggtctc cggcatccag        60
     cccgatcccg acctgtgggt ggtggtcgcg accctggtgg cggcgctcgc cgtcgtcgcg       120
     acgcgcggat cgtggcggat agcgcgcaac gcgatcacca tcgcgcacga gggcggtcac       180
     ggcctggtgg ccctgctgac cggccgtacc ctcaccggga tcaccctgca ctcggacacc       240
     agcggtctga cggtgagccg gggcaagccg cacggcgtcg gcatgatcct caccgcggtc       300
     gccggttaca ccgctccgcc gctgctcggc ctcggcggcg ccgcactgct ggcggccggg       360
     cgcatcacgc tgctgctgtg gctggcgacg gcgctgctgg tggccctgct ggtgatggtc       420
     cgcaacgcgt acggggtgct gacggtcgtg gtcaccggcg gcacgttcgt cctggtgtcg       480
     tggctggccg ggccgcaggt gcaggcggcg ttcgcgtacg cggtggtctg gttccttctc       540
     ctcggcggag tgcgcccggc cttcgagctg caggccaagc ggtcgcgggg cggcgccggc       600
     gactcggacg ccgaccagtt ggcgcggctg acccacgcgc cggcgggagt gtggttcttc       660
     ctcttccacg cggtgtcgct gtgctcgctg atcggcgggg cgcgctggct actggagctg       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page