(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5214

AL939122.SCO5214     Location/Qualifiers
FT   CDS_pept        303488..304303
FT                   /transl_table=11
FT                   /gene="SCO5214"
FT                   /gene_synonym="SC7E4.11"
FT                   /product="conserved hypothetical protein SC7E4.11"
FT                   /note="SC7E4.11, hypothetical protein, len: 271 aa; similar
FT                   to TR:O05872 (EMBL:Z95121) Mycobacterium tuberculosis
FT                   hypothetical 27.6 kD protein MTCY20B11.01c, 252 aa; fasta
FT                   scores: opt: 383 z-score: 460.8 E(): 3.4e-18; 39.6%
FT                   identity in 283 aa overlap"
FT                   /db_xref="GOA:Q9K4A5"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A5"
FT                   /protein_id="CAB94599.1"
FT                   /translation="MCGRYAASRRPEDLAGIFEIEKWEPKESLEPDYNVAPTKEVYAVL
FT                   DRPLKDVEDPEPVRQLRKLKWGLVPSWSKTPEGGARMINARAETVHEKPSYRRAFSTRR
FT                   CILPADGYYEWVTGKQERDLEVEGRKKRPRKQPYFVTPADGSVFAMAGLYEFWRDRTLP
FT                   DDHPQAWWVTCSVITTEAETTPLAVAPADGPHALADIHPRMPLMLTPDRWDDWLDPART
FT                   DPDELTSLLAPPPTGLMRAFPVSTAVSNVRNNGPELLEELEAPEEGTLF"
     atgtgcggac ggtatgcggc gagtcgtcga cccgaggatc tcgcgggaat cttcgagatc        60
     gagaagtggg agcccaagga gagcttggaa cccgactaca acgtggcccc caccaaggag       120
     gtctacgccg tcctggaccg tcccctgaaa gacgtcgagg acccggagcc ggttcgccag       180
     ctgcggaagc tgaagtgggg cctcgtcccc tcctggtcca agacgcccga gggcggcgcc       240
     cggatgatca acgcccgcgc ggagaccgtc cacgagaagc cctcctaccg ccgcgccttc       300
     agcacccggc gctgcatcct gcccgccgac ggctactacg agtgggtcac cggcaagcag       360
     gagcgagacc tggaggtcga agggcgcaag aagcggccgc gcaagcagcc gtacttcgtg       420
     acccccgccg acggctccgt gttcgccatg gccgggctct acgagttctg gcgggacagg       480
     acgctgcccg acgaccatcc gcaggcatgg tgggtgacgt gctcggtgat cacgaccgag       540
     gccgagacca caccactcgc cgtcgccccg gccgacggtc cgcacgccct ggccgacatc       600
     cacccccgga tgccgctgat gctgacgccg gaccgctggg acgactggct cgatccggcg       660
     cgcaccgacc ccgacgagct gacctccctg ctggcacccc cgcccaccgg cctgatgcgg       720
     gccttccccg tctcgacggc cgtgagcaac gtccgcaaca acggaccgga gctgctcgag       780
     gagctggaag caccggaaga gggcacactc ttctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page