(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5215

AL939122.SCO5215     Location/Qualifiers
FT   CDS_pept        304326..304961
FT                   /transl_table=11
FT                   /gene="SCO5215"
FT                   /gene_synonym="SC7E4.12"
FT                   /product="hypothetical protein"
FT                   /note="SC7E4.12, hypothetical protein, len: 211 aa; similar
FT                   to TR:P96267 (EMBL:Z84724) Mycobacterium tuberculosis
FT                   hypothetical 21.7 kD protein MTCY22G10.18c, 209 aa; fasta
FT                   scores: opt: 255 z-score: 287.1 E(): 1.6e-08; 29.8%
FT                   identity in 205 aa overlap"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A4"
FT                   /protein_id="CAB94600.1"
FT                   /translation="MTEAVETDAGPARITWHRAKQPRLVLAVSHGAGGGIEARDLKALA
FT                   AALPAHGVSVALVEQPWRVAGRKLAPAPKTLDTGWRGVWPALAAPGLPVISGGRSAGAR
FT                   VACRTAGELGARAVLALSFPLHPPGRPEKSRADELLGAGVPTLVVQGGNDPFGRPHEFP
FT                   EAPGGTYDLIEVPYGDHGFAVPKRAEISQERALELITDGVAQWAGSLG"
     gtgacagagg cggtcgagac ggatgcgggc cccgcccgca tcacctggca ccgggcgaag        60
     cagccccggc tggtgctcgc cgtgagccac ggggccggcg gcggcatcga ggcgcgcgac       120
     ctgaaggcgc tggcggccgc actgcccgcc cacggggtga gcgtggccct cgtcgagcag       180
     ccctggcggg tggcgggcag gaagctggcg cccgcgccga agaccctcga caccgggtgg       240
     cggggcgtct ggcccgcgct cgccgccccc ggcctgccgg tgatctcggg cggccgcagc       300
     gccggcgccc gtgtcgcctg ccgcaccgcc ggcgaactgg gcgcccgcgc cgtcctcgcc       360
     ctcagcttcc ccctgcaccc gccgggcagg ccggagaagt cccgcgccga cgagctgctc       420
     ggggccggcg tgcccaccct cgtggtccag ggcggcaacg accccttcgg caggccgcac       480
     gagttccccg aggcgcccgg agggacctac gacctgatcg aggtgccgta cggcgaccac       540
     ggcttcgccg tgcccaaacg ggcggagatc agccaggaaa gggcgctgga gctgatcacc       600
     gacggcgtgg cccagtgggc cggctcactc ggctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page