(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5218

AL939122.SCO5218     Location/Qualifiers
FT   CDS_pept        306345..307670
FT                   /transl_table=11
FT                   /gene="SCO5218"
FT                   /gene_synonym="SC7E4.15"
FT                   /product="putative integral membrane protein"
FT                   /note="SC7E4.15, possible integral membrane protein, len:
FT                   441 aa; similar to TR:Q9X1H8 (EMBL:AE001797) Thermotoga
FT                   maritima conserved hypothetical protein TM1467, 426 aa;
FT                   fasta scores: opt: 471 z-score: 536.1 E(): 2.2e-22; 29.0%
FT                   identity in 352 aa overlap. Contains possible N-terminal
FT                   signal peptide sequence and possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9K4A3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A3"
FT                   /protein_id="CAB94603.1"
FT                   /translation="MDAVPARARVYVAVVALTALLCLRPLPAVRAPWWAVLLLAGLYAG
FT                   SELVARSRFVGTCYPVLLAGAFLLPPPAAALVALPGALLAPVPRRPLGLRRVWRAAQLT
FT                   LAVWAAACVHWRLGGRDAVVEPAFPYALVPAGAAVLAFCLVLTVLDGGILTLADHVPPS
FT                   RAWRGLLSRSLAPIAVHGLAGLMMAVLWRSPYGPVAALLVLLPMCVAWWAFAQYHRERA
FT                   AHQATIRALVQAVDIKDGYTRGHSERVGQASMMIARELGMDDERVETLRFAGILHDVGK
FT                   LGVPTRLLRKDGPLTPEERRVIELHPEYGHEMVRGIRFLGEARAAVLHHHERLDGSGYP
FT                   YGLAGDRIPESARVVAVADAFDAMTSTRSYSRARPVATALAELQRCAGGQFDPRMVRAL
FT                   VRALGRHGWRPSVTADSPLTRTAGPAPDRGEDARDSVGRGAP"
     atggacgcgg taccggcgcg ggcacgtgtg tacgtggccg tcgtcgccct caccgccctg        60
     ctctgcctgc gaccgctgcc cgcggtgcgc gcgccctggt gggcggtgct gctgctggcg       120
     gggctgtacg cggggtccga gctggtcgcg cggtcccgct tcgtcgggac ctgctacccc       180
     gtcctgctcg ccggcgcctt cctgctgccg ccgcccgccg ccgcgctcgt ggcactgccg       240
     ggagccctgc tggccccggt gccgcgccgt cccctcggcc tgcggcgcgt gtggcgggcc       300
     gcgcagctga ctctcgccgt gtgggccgcg gcctgtgtcc actggcggct cgggggccgg       360
     gacgcggtcg tcgagcccgc cttcccgtac gccctcgtgc cggccggggc ggccgtactc       420
     gccttctgcc tggtcctcac cgtgctggac ggcggcatcc tcaccctcgc cgaccacgtg       480
     ccgccgagcc gggcgtggcg gggactgctc tcccggtcgc tcgcgccgat cgccgtgcac       540
     gggctcgccg ggctcatgat ggccgtcctg tggcgcagcc cgtacggtcc ggtggccgcg       600
     ctgctcgtgc tgctgccgat gtgcgtggcc tggtgggcct tcgcccagta ccaccgtgag       660
     cgggccgcgc accaggcgac catccgcgcc ctcgtgcagg ccgtcgacat caaggacggc       720
     tacacgcgcg gccacagcga acgcgtcggc caggcctcca tgatgatcgc ccgcgagctg       780
     ggcatggacg acgaacgcgt cgagaccctg cgcttcgccg ggatcctgca cgacgtgggc       840
     aagctcggcg tgcccacccg gctgctgcgc aaggacggcc cgctgacgcc cgaggagcgc       900
     cgggtgatcg aactgcaccc cgagtacggg cacgagatgg tgcgcggcat ccgcttcctg       960
     ggagaggccc gcgccgccgt cctgcaccac cacgaacggc tggacggcag cggctatccc      1020
     tacgggctgg ccggcgaccg gatccccgag tcggcccggg tggtggccgt cgccgacgcc      1080
     ttcgacgcga tgacgtccac gcgctcctac agcagggccc ggcccgtcgc gacggcgctg      1140
     gcggagctcc agcggtgtgc cggcggacag ttcgacccgc ggatggtgcg ggcactggtc      1200
     cgggccctcg gccggcacgg ctggcgcccg tccgtcacgg cggactcccc gctcacccgc      1260
     accgccggac cggcaccgga ccggggcgag gacgcgcggg acagcgtcgg caggggagcg      1320
     ccatga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page