(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5219

AL939122.SCO5219     Location/Qualifiers
FT   CDS_pept        307676..308932
FT                   /transl_table=11
FT                   /gene="SCO5219"
FT                   /gene_synonym="SC7E4.16"
FT                   /product="putative lipoprotein"
FT                   /note="SC7E4.16, possible lipoprotein, len: 418 aa.
FT                   Contains correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site,
FT                   possible N-terminal region signal peptide sequence and
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A2"
FT                   /protein_id="CAB94604.1"
FT                   /translation="MQPPARSSPPAAVLLVPGCAGLLALGCLASVLGAGPAQRPVALAF
FT                   GGLVVLGELTRRTGAEAREAAPLGAAGALAYALLGDVAGQPAHHGVAETVTVVLAASLL
FT                   GSVPYVARGSGPVLDHLARRVLTVGFAAVCFRPLSNQGVFDDWSGPAYALLLLGLLALT
FT                   TLCDAVLAAAPAHARTGWPFGPLLREELRGMVGITSAVCATGAVMALAVSVAGLWALPV
FT                   FSVPLLLAQLSYRRYAAVRATYRQTIASLARATEIAGYTPAGHARRVAGLGVAVGRDLG
FT                   LSGAELTVLEYAALMHDIGQLSLVDPVPAGATAGLPVTEQRRIALLGGAVVRQTGVDAA
FT                   VAVVVERQADPCREQPVAARIVRVVNAYDEKARDAGPGGVLTALEELRLATAGDYAPEV
FT                   VEALARVLSRGSLTEPAAG"
     ttgcagccgc cggcccggtc ctcgccgccg gcggccgtcc tcctcgtacc cggctgtgcc        60
     gggctcctcg cgctcggatg tctcgcctcc gtgctggggg cggggcccgc ccagcggccc       120
     gtcgcgctgg ccttcggagg gctggtcgtc ctcggtgagc tgacccggcg gaccggcgcc       180
     gaggcccggg aggcggctcc gctcggtgcc gcgggcgcac tggcgtacgc gctgctcgga       240
     gacgtcgccg ggcagcccgc gcaccacggt gtggccgaga ccgtcaccgt cgtgctcgcc       300
     gcctcgctgc tcggcagcgt gccctacgtc gcgcgcggca gcgggcccgt cctcgaccac       360
     ctggcgcggc gcgtgctcac cgtcggtttc gccgccgtgt gcttccggcc gctgtccaac       420
     cagggcgtct tcgacgactg gagcggcccc gcctacgcgc tgctgctgct cgggctgctc       480
     gccctgacca cgctgtgcga cgcggtgctc gccgcggcac ccgcgcacgc gcgcaccggc       540
     tggcccttcg ggcccctgct gcgcgaagag ctgcgcggca tggtcgggat cacgtcggcg       600
     gtgtgcgcga ccggcgcggt gatggcgctc gcggtgagcg tcgcgggact gtgggcgctc       660
     cccgtcttct ccgtgcccct gctgctcgcc cagctctcct accggcggta cgcggccgtc       720
     cgggccactt accggcagac catcgcctcc ctggcccgcg ccaccgagat cgccggatac       780
     accccggccg ggcacgcgcg ccgcgtcgcc gggctcgggg tggccgtcgg ccgggacctg       840
     gggctgtcgg gggccgagct gaccgtgctg gagtacgcgg ccctcatgca cgacatcggc       900
     cagctgagcc tggtcgaccc ggtcccggcg ggtgccacgg ccggcctgcc ggtcaccgaa       960
     cagcggcgga tcgcgctgct cggcggggcc gtcgtccgcc agaccggcgt cgacgcggcg      1020
     gtcgcggtgg tggtggagcg gcaggccgac ccctgccggg agcagccggt cgccgcgcgg      1080
     atcgtacgcg tcgtgaacgc ctacgacgag aaggcgcggg acgcgggtcc cggcggcgtc      1140
     ctgaccgcgc tggaggagct gcgcctggcc accgcgggcg actacgctcc ggaagtggtg      1200
     gaagcgctgg cccgggtcct ttcccgaggc agccttaccg agcccgcggc tgggtaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page