(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5221

AL939122.SCO5221     Location/Qualifiers
FT   CDS_pept        310107..310757
FT                   /transl_table=11
FT                   /gene="SCO5221"
FT                   /gene_synonym="SC7E4.18"
FT                   /product="putative polypeptide deformylase"
FT                   /note="SC7E4.18, probable polypeptide deformylase, len: 216
FT                   aa; similar to SW:DEF_FREDI (EMBL:Y10305) Fremyella
FT                   diplosiphon polypeptide deformylase (EC 3.5.1.31) Def, 187
FT                   aa; fasta scores: opt: 353 z-score: 430.0 E(): 1.8e-16;
FT                   33.8% identity in 145 aa overlap and to TR:Q9XAQ2
FT                   (EMBL:AL078618) Streptomyces coelicolor putative
FT                   polypeptide deformylase SC10A7.23, 208 aa; fasta scores:
FT                   opt: 680 z-score: 796.7 E(): 0; 59.8% identity in 169 aa
FT                   overlap. Contains Pfam match to entry PF01327
FT                   Pep_deformylase, Polypeptide deformylase"
FT                   /db_xref="GOA:Q9K4A0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4A0"
FT                   /protein_id="CAB94606.1"
FT                   /translation="MAQQDTDQQHPGVLPVDDEGFVVDSQDCEEREADWRGRGTSRPIT
FT                   VVGNPVLHKECEDVTDFGEEFQQLVADMFASQRTAEGVGLAANQIGVSKKVFVYDCPDD
FT                   EGVRHVGVVCNPRLVELPADRRRLDDSNEGCLSVPTAYAPLARPDYAEVTGQDEKGNPV
FT                   KVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAENEPRYPVVAND"
     atggcccagc aggacaccga tcagcagcac ccgggcgtgc tccccgtgga cgacgaggga        60
     ttcgtcgtcg acagccagga ctgcgaggag cgtgaggccg actggcgcgg gcgcggcacc       120
     tcccgtccga tcacggtggt cggcaacccg gtgctgcaca aggagtgcga ggacgtcacc       180
     gacttcggcg aggagttcca gcagctggtg gccgacatgt tcgccagcca gcgcaccgcc       240
     gagggagtgg gcctggccgc caaccagatc ggcgtctcca agaaggtctt cgtctacgac       300
     tgccccgacg acgagggcgt ccgccacgtc ggcgtggtct gcaacccgcg gctcgtcgag       360
     ctgccggccg accgccgccg cctggacgac agcaacgagg gctgcctgtc cgtgcccacc       420
     gcctacgcgc cgctcgcccg ccccgactac gccgaggtga ccgggcagga cgagaagggc       480
     aacccggtca aggtgcgcgg cacggggtac ttcgcccggt gtttgcagca cgagacggac       540
     cacctgtacg ggtacctgta catcgaccgg ctctccaagc gcgaacgcaa ggacgcgctt       600
     cggcagatgg ccgagaacga gccgcgctac cccgtggtcg cgaacgactg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page