(data stored in ACNUC27125 zone)

EMBL: AL954360.FAM21B

AL954360.FAM21B      Location/Qualifiers
FT   CDS_pept        join(<2096..2158,4180..4353,7475..7568,8905..8966,
FT                   10683..10730,14202..14312,14857..14944,15588..15659,
FT                   16694..16812,17286..17343,18573..18632,19024..19203,
FT                   21100..21227,23402..23488,27466..27567,29759..29890,
FT                   33527..33696,37319..37421,41331..41483,43012..43194,
FT                   48542..48670,48798..48878,49486..49608,51012..51224,
FT                   52848..53468,54333..54510,56238..56377)
FT                   /codon_start=1
FT                   /gene="FAM21B"
FT                   /locus_tag="RP11-98I6.1-002"
FT                   /standard_name="OTTHUMP00000019527"
FT                   /product="family with sequence similarity 21, member B"
FT                   /note="match: proteins: Sw:Q9Y4E1"
FT                   /db_xref="GOA:Q641Q2"
FT                   /db_xref="HGNC:HGNC:23416"
FT                   /db_xref="InterPro:IPR029341"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q641Q2"
FT                   /protein_id="CAI17187.1"
FT                   /translation="RVYDEEVEEPVLKAEAEKTEQEKTREQKEVDLIPKVQEAVNYGLQ
FT                   VLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYIDRPLPYLIGSKLFMEQEDVGL
FT                   GELSSEEGSVGSDRGSIVDTEEEKEEEESDEDFAHHSDNEQNRHTTQMSDEEEDDDGCD
FT                   LFADSEKEEEDIEDIEENTRPKRSRPTSFADELAARIKGDAVGRVDEEPTTLPSGEAKP
FT                   RKTLKEKKERRTPSDDEEDNLFTPPKLTDEDFSPFGSGGGLFSGGKGLFDDEDEESDLF
FT                   TEAPQDRQAGASVKEESSSSKPGKKIPAGAVSVFLGDTDVFGAASVPSMKEPQKPEQPT
FT                   PRKSPYGPPPTGLFDDDDGDDDDDFFSAPHSKPSKTGKVQSTADIFGDEEGDLFKEKAV
FT                   ASPEATVSQTDENKARAEKKVTLSSSKNLKPSSETKTQKGLFSDEEDSEDLFSSQSASK
FT                   LKGASLLPGKLPTSVSLFDDEDEEDNLFGGTAAKKQTLCLQAQREEKAKASELSKKKAS
FT                   ALLFSSDEEDQWNIPASQTHLASDSRSKGEPRDSGTLQSQEAKAVKKTSLFEEDEEDDL
FT                   FAIAKDSQKKTQRVSLLFEDDVDSRGSLFGSPPTSVPPATKKKETVSEAPPLLFSDEEE
FT                   KEAQLGVKSVDKKVESAKESLKFGRTDVAESEKEGLLTRSAQETVKHSDLFSSSSPWDK
FT                   GTKPRTKTVLSLFDEEEDKMEDQNIIQAPQKEVGKGRDPDAHPKSTGVFQDEELLFSHK
FT                   LQKDNDPDVDLFAGTKKTKLLEPSVGSLFGDDEDDDLFSSAKSQPLVQEKKRVVKKDHS
FT                   VDSFKNQKHPESIQGSKEKGIWKPETPQANLAINPAALLPTAASQISEVKPVLPELAFP
FT                   SSEHRRSHGLESVPVLPGSGEAGVSFDLPAQADTLHSANKSRVKMRGKRRPQTRAARRL
FT                   AAQESSETEDMSVPRGPIAQWADGAISPNGHRPQLRAASGEDSTEEALAAAAAPWEGGP
FT                   VPGVDRSPFAKSLGHSRGEADLFDSGDIFSTGTGSQSVERTKPKAKIAENPANPPVGGK
FT                   AKSPMFPALGEASSDDDLFQSAKPKPAKKTNTFPLLEDEDDLFTDQKVKKNETKSNSQQ
FT                   DVILTTQDIFEDDIFATEAIKPSQKTREKEKTLESNLFDDNIDIFADLTVKPKEKSKKK
FT                   VEAKSIFDDDMDDIFSSGIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ"
     cgtgtatatg atgaagaagt ggaggagcca gtactcaagg ctgaggcaga aaaaacagag        60
     caggagaaga cacgagagca gaaagaagta gatctcattc ctaaagtcca ggaggctgtg       120
     aactatggct tacaagtatt ggacagtgcc tttgagcaac ttgatatcaa agcaggaaac       180
     tcagactccg aggaagatga tgctaatggg cgggtggaac tgatccttga accaaaggat       240
     ctatacattg atcgtccttt accatatctc attgggtcaa agctgttcat ggaacaagaa       300
     gatgtaggtc ttggagagct gtccagtgaa gaaggctctg taggcagtga tcgtggcagt       360
     attgtggaca ctgaggaaga gaaagaagag gaggagtcag atgaagattt tgcccatcat       420
     agtgacaatg aacaaaaccg gcacaccaca caaatgagtg atgaggaaga ggatgatgat       480
     ggctgtgacc ttttcgctga ctctgagaag gaggaggaag atattgagga cattgaagaa       540
     aatactagac ctaaaagaag cagacctaca tcgtttgcag atgagctggc tgcccgcatc       600
     aagggggatg ccgtgggtcg agtggacgag gagccgacaa ccttaccctc aggagaagca       660
     aaacctcgga agacactcaa agagaagaag gaaaggagaa ctccttcaga cgatgaagag       720
     gataacttat tcacaccccc caagctgacc gacgaggact tctcgccatt tggctctgga       780
     ggtggcctgt tcagtggggg caaggggcta tttgatgatg aggacgagga gagtgacctc       840
     ttcacggaag ccccccagga tcggcaagct ggagcctctg ttaaggagga gtcttcatca       900
     tccaaacctg gaaagaaaat cccagcagga gctgtttctg tatttttagg agacacggat       960
     gtgtttggtg ctgcctccgt tccatcaatg aaggagccac agaagcctga gcagcccact      1020
     ccaaggaaaa gcccctatgg tccccctccc actggcctct ttgatgatga tgatggtgat      1080
     gatgatgacg actttttctc ggcaccccac agcaaacctt ctaaaacagg caaagtccaa      1140
     tccactgccg atatctttgg tgacgaagaa ggagatctgt tcaaagaaaa agccgtagca      1200
     tcgccagaag ccactgtgag tcagacagat gaaaataaag caagagcaga aaaaaaggtt      1260
     accttatctt ccagcaaaaa tctcaagccc tcatcagaaa caaagactca aaaaggctta      1320
     ttttcagatg aggaggactc tgaggatttg ttttcttctc aaagtgcgag taagttaaaa      1380
     ggtgcatctc tgctgcctgg caagctcccc acgtcggttt ccctgtttga tgatgaagat      1440
     gaagaggata atctttttgg gggtacagct gctaagaagc agacattgtg tctacaagct      1500
     cagagagaag agaaagcaaa agcctccgag ctctccaaaa agaaagcatc tgccctgttg      1560
     ttcagcagtg atgaggagga ccagtggaat attcctgctt cacagaccca cttagcatct      1620
     gacagcaggt ctaaaggaga acccagggat tctgggaccc tccagagcca ggaggccaag      1680
     gctgtgaaaa agaccagtct ctttgaggaa gacgaagaag atgatctttt tgccattgcc      1740
     aaggacagcc aaaagaagac ccagagagtg tcactcctct ttgaagacga tgttgatagc      1800
     cgaggctctc tgtttggctc tcctcccaca tctgttcctc ctgcaacaaa gaaaaaagag      1860
     actgtctctg aggcaccacc tttgctgttc agcgatgaag aagagaagga ggcacaactt      1920
     ggagtgaagt ctgtggataa gaaggttgag agtgccaagg agtcattaaa atttgggaga      1980
     actgatgtgg ctgagtcaga aaaggaagga cttttgacta gatctgctca ggaaacagtc      2040
     aagcattctg atttattttc ttcatcatcc ccatgggaca aaggaaccaa gcctagaacc      2100
     aaaactgttc ttagcttgtt tgatgaggaa gaggataaaa tggaagatca aaacattatc      2160
     caggctccac agaaagaagt aggaaagggc cgcgatcctg atgcccaccc caagagcaca      2220
     ggtgtcttcc aggatgaaga gctgcttttc agccacaagc tccaaaagga caatgaccca      2280
     gatgttgacc tttttgctgg caccaaaaaa accaagctgt tagagccaag tgttgggagc      2340
     ctgtttgggg atgatgaaga tgatgatctt ttcagctctg ccaagtccca gcctttggta      2400
     caagagaaaa agagagtagt gaaaaaagac cactctgttg actctttcaa aaaccagaaa      2460
     catcctgaat ccattcaagg tagtaaagaa aaaggcatat ggaagccaga aacacctcag      2520
     gcaaatttag cgatcaaccc agcggccttg ctgcccacag cggcttccca gatctctgaa      2580
     gtaaagcctg ttttgccaga attggctttt ccttcatctg aacacagaag gagccacggt      2640
     ctggaaagtg tgcctgtcct tcccgggagt ggggaggccg gtgtgagttt tgatcttcca      2700
     gctcaggcag acaccttaca cagtgcaaac aagagccgtg tcaagatgag agggaagcgt      2760
     agaccgcaga cccgtgcagc taggcggctg gctgctcagg agtccagcga gactgaggac      2820
     atgagcgtcc ccagaggacc cattgcacag tgggctgatg gcgccatttc cccaaatggc      2880
     catcggccac agctcagagc agccagtgga gaagacagca ctgaggaggc cctggcagct      2940
     gccgctgcac cttgggaagg tggtcctgtg cctggagtgg acagaagccc ctttgcaaag      3000
     tctctgggtc attccagagg ggaggctgac ctttttgatt ctggggacat cttttccacg      3060
     ggcactggat ctcagtctgt ggagagaaca aaacccaagg caaagatagc agagaatcct      3120
     gccaacccac cagtgggtgg taaagcaaag agccccatgt ttcctgctct aggtgaggcc      3180
     agcagtgatg atgatctctt tcagtctgct aaaccaaaac cagcaaagaa aacaaatacc      3240
     tttcctctcc tggaagatga ggatgacctc tttacagatc agaaagtcaa gaagaatgag      3300
     acaaaatcca atagtcagca ggatgtcata ttaacaacac aagatatttt tgaggatgat      3360
     atatttgcta cggaagcaat taaaccctct cagaaaacca gagagaagga gaaaacattg      3420
     gaatctaatt tatttgatga taacattgat atctttgctg acttaactgt aaaaccaaaa      3480
     gaaaagtcca aaaagaaagt ggaagccaag tctatatttg atgatgatat ggatgacatc      3540
     ttctcctctg gtatccaggc taagacaacc aaaccaaaaa gccgatctgc acaggccgca      3600
     cctgaaccaa gatttgaaca caaggtgtcc aacatctttg atgatcccct gaatgccttt      3660
     ggaggccagt ag                                                          3672
//

If you have problems or comments...

PBIL Back to PBIL home page