(data stored in ACNUC27125 zone)

EMBL: AL954360.PE2

AL954360.PE2         Location/Qualifiers
FT   CDS_pept        join(<48804..48878,49486..49608,50589..50651,51012..51224,
FT                   52848..>53200)
FT                   /codon_start=1
FT                   /gene="FAM21B"
FT                   /locus_tag="RP11-98I6.1-003"
FT                   /standard_name="OTTHUMP00000019528"
FT                   /product="family with sequence similarity 21, member B"
FT                   /db_xref="InterPro:IPR029341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SNT8"
FT                   /protein_id="CAI17188.1"
FT                   /translation="EPSVGSLFGDDEDDDLFSSAKSQPLVQEKKRVVKKDHSVDSFKNQ
FT                   KHPESIQGSKEKGIWKPETPQDSSGLAPFKTKEPSTRIGKIQANLAINPAALLPTAASQ
FT                   ISEVKPVLPELAFPSSEHRRSHGLESVPVLPGSGEAGVSFDLPAQADTLHSANKSRVKM
FT                   RGKRRPQTRAARRLAAQESSETEDMSVPRGPIAQWADGAISPNGHRPQLRAASGEDSTE
FT                   EALAAAAAPWEGGPVPGVDRSPFAKSLGHSRGEADLFDSGDIFSTGTGSQSVE"
     gagccaagtg ttgggagcct gtttggggat gatgaagatg atgatctttt cagctctgcc        60
     aagtcccagc ctttggtaca agagaaaaag agagtagtga aaaaagacca ctctgttgac       120
     tctttcaaaa accagaaaca tcctgaatcc attcaaggta gtaaagaaaa aggcatatgg       180
     aagccagaaa cacctcagga ctcatcaggt ctcgctccat ttaaaaccaa agaaccatcc       240
     actcggatcg ggaagataca agcaaattta gcgatcaacc cagcggcctt gctgcccaca       300
     gcggcttccc agatctctga agtaaagcct gttttgccag aattggcttt tccttcatct       360
     gaacacagaa ggagccacgg tctggaaagt gtgcctgtcc ttcccgggag tggggaggcc       420
     ggtgtgagtt ttgatcttcc agctcaggca gacaccttac acagtgcaaa caagagccgt       480
     gtcaagatga gagggaagcg tagaccgcag acccgtgcag ctaggcggct ggctgctcag       540
     gagtccagcg agactgagga catgagcgtc cccagaggac ccattgcaca gtgggctgat       600
     ggcgccattt ccccaaatgg ccatcggcca cagctcagag cagccagtgg agaagacagc       660
     actgaggagg ccctggcagc tgccgctgca ccttgggaag gtggtcctgt gcctggagtg       720
     gacagaagcc cctttgcaaa gtctctgggt cattccagag gggaggctga cctttttgat       780
     tctggggaca tcttttccac gggcactgga tctcagtctg tggagag                     827
//

If you have problems or comments...

PBIL Back to PBIL home page