(data stored in ACNUC7421 zone)


ID   ALDEN1_2; SV 1; empty ; DNA; empty ; PRO; 4637013 BP.
AC   NC_014910;
PR   Project: 49953;
DE   Alicycliphilus denitrificans BC chromosome, complete genome.
OS   Alicycliphilus denitrificans BC
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Alicycliphilus.
RN   [1]
RP   1-4637013
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
RA   Daligault,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., Mikhailova,N., Oosterkamp,M.J., Veuskens,T.,
RA   Weelink,S.A., Plugge,C.M., Stams,A.J.M. and Woyke,T.;
RT   "Complete sequence of chromosome of Alicycliphilus denitrificans BC";
RL   Unpublished
RN   [2]
RP   1-4637013
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (13-JAN-2011) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
RN   [3]
RP   1-4637013
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
RA   Daligault,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., Mikhailova,N., Oosterkamp,M.J., Veuskens,T.,
RA   Weelink,S.A., Plugge,C.M., Stams,A.J.M. and Woyke,T.;
RT   "Direct Submission";
RL   Submitted (03-JAN-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002449.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086861
CC   Source DNA and organism available from Alfons J.M. Stams
CC   (Fons.Stams@wur.nl)
CC   Contacts: Alfons J.M. Stams (Fons.Stams@wur.nl)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Alicycliphilus denitrificans BC
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Missing
CC   num_replicons       :: 3
CC   ref_biomaterial     :: JCM 14587
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.2 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03280
CC   Greengenes ID       :: 39244
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: WGS
CC   ##Genome-Assembly-Data-END##
CC   COMPLETENESS: full length.
FH   Key             Location/Qualifiers
FT   source          1..4637013
FT                   /strain="BC"
FT                   /mol_type="genomic DNA"
FT                   /organism="Alicycliphilus denitrificans BC"
FT                   /db_xref="taxon:596153"
FT   gene            206..1627
FT                   /db_xref="GeneID:10106510"
FT                   /locus_tag="Alide_0001"
FT   CDS_pept        206..1627
FT                   /locus_tag="Alide_0001"
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein dnaa"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   dia:Dtpsy_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="GI:319760739"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003688"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:10106510"
FT                   ELNQQLHVLEQTLKG"
FT                   /protein_id="YP_004124676.1"
FT   misc_feature    <224..>490
FT                   /note="hypothetical protein; Validated; Region: PRK06672"
FT                   /db_xref="CDD:180654"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    260..1624
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:178902"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    716..1087
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    737..760
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    order(740..763,926..928,1025..1027)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    914..931
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    1076..1078
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    1349..1618
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Alide_0001"
FT   misc_feature    order(1418..1420,1442..1447,1466..1468,1484..1492,
FT                   1517..1531,1538..1540,1547..1552)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Alide_0001"
FT   gene            1754..2860
FT                   /db_xref="GeneID:10102025"
FT                   /locus_tag="Alide_0002"
FT   CDS_pept        1754..2860
FT                   /locus_tag="Alide_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: dia:Dtpsy_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:319760740"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:10102025"
FT                   /product="DNA polymerase iii, beta subunit"
FT                   /protein_id="YP_004124677.1"
FT   misc_feature    1763..2857
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:180180"
FT                   /locus_tag="Alide_0002"
FT   misc_feature    1763..2854
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Alide_0002"
FT   misc_feature    order(1826..1828,1973..1975,1994..1996,2351..2353)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Alide_0002"
FT   misc_feature    order(1976..1978,1985..1987,2063..2065,2069..2071,
FT                   2573..2575,2666..2671)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Alide_0002"
FT   misc_feature    order(2273..2275,2279..2290,2717..2719,2843..2854)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Alide_0002"
FT   misc_feature    order(2273..2275,2279..2284,2498..2500,2603..2605,
FT                   2642..2647,2726..2728,2843..2854)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Alide_0002"
FT   gene            2979..5561
FT                   /db_xref="GeneID:10102026"
FT                   /locus_tag="Alide_0003"
FT   CDS_pept        2979..5561
FT                   /locus_tag="Alide_0003"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /product="DNA gyrase, b subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; KEGG: dia:Dtpsy_0003 DNA gyrase, B subunit; SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="GI:319760741"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="GeneID:10102026"
FT                   /protein_id="YP_004124678.1"
FT   misc_feature    3042..5558
FT                   /note="DNA gyrase subunit B; Provisional; Region: gyrB;
FT                   PRK14939"
FT                   /db_xref="CDD:184903"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    3135..3446
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    order(3153..3155,3165..3167,3174..3176,3240..3242,
FT                   3246..3248,3252..3254,3258..3263,3390..3401)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    3165..3167
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    order(3252..3254,3258..3260,3390..3392,3396..3398)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    3735..4235
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    3918..3920
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    order(4092..4094,4101..4106,4110..4112)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    order(4110..4112,4116..4118)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    4359..4736
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    order(4377..4382,4389..4391,4632..4634,4638..4640,
FT                   4644..4646)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    order(4377..4379,4632..4634)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Alide_0003"
FT   misc_feature    5355..5525
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Alide_0003"
FT   gene            5636..6049
FT                   /db_xref="GeneID:10102027"
FT                   /locus_tag="Alide_0004"
FT   CDS_pept        5636..6049
FT                   /locus_tag="Alide_0004"
FT                   /gene_family="HOG000286103" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dia:Dtpsy_0006 protein of unknown function UPF0153"
FT                   /db_xref="GI:319760742"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="GeneID:10102027"
FT                   /protein_id="YP_004124679.1"
FT   misc_feature    5669..6046
FT                   /note="Uncharacterized protein family (UPF0153); Region:
FT                   UPF0153; cl00497"
FT                   /db_xref="CDD:186037"
FT                   /locus_tag="Alide_0004"
FT   gene            complement(6074..7267)
FT                   /db_xref="GeneID:10102028"
FT                   /locus_tag="Alide_0005"
FT   CDS_pept        complement(6074..7267)
FT                   /locus_tag="Alide_0005"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_A2137 acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="GI:319760743"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102028"
FT                   /protein_id="YP_004124680.1"
FT   misc_feature    complement(6098..7258)
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0005"
FT   gene            complement(7277..8134)
FT                   /db_xref="GeneID:10102029"
FT                   /locus_tag="Alide_0006"
FT   CDS_pept        complement(7277..8134)
FT                   /locus_tag="Alide_0006"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A2138 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="GI:319760744"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102029"
FT                   LDLA"
FT                   /protein_id="YP_004124681.1"
FT   misc_feature    complement(7319..8107)
FT                   /note="enoyl-CoA hydratase; Provisional; Region: PRK06688"
FT                   /db_xref="CDD:180658"
FT                   /locus_tag="Alide_0006"
FT   misc_feature    complement(7532..8107)
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0006"
FT   misc_feature    complement(order(7691..7693,7700..7705,7769..7777,
FT                   7781..7783,7922..7936,7946..7948,8042..8044,8048..8050))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0006"
FT   misc_feature    complement(order(7769..7771,7928..7930))
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0006"
FT   misc_feature    complement(order(7565..7567,7574..7576,7607..7609,
FT                   7616..7621,7625..7630,7634..7639,7652..7657,7661..7669,
FT                   7673..7675,7688..7699,7733..7744,7805..7807,7829..7831))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0006"
FT   gene            8188..9030
FT                   /db_xref="GeneID:10102030"
FT                   /locus_tag="Alide_0007"
FT   CDS_pept        8188..9030
FT                   /locus_tag="Alide_0007"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: reh:H16_A2139 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760745"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102030"
FT                   /protein_id="YP_004124682.1"
FT   misc_feature    8197..9003
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0007"
FT   misc_feature    8203..8379
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0007"
FT   misc_feature    8467..9006
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0007"
FT   misc_feature    order(8509..8514,8518..8523,8530..8532,8542..8544,
FT                   8548..8568,8812..8829,8845..8850,8854..8859)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Alide_0007"
FT   gene            complement(9027..10049)
FT                   /db_xref="GeneID:10102031"
FT                   /locus_tag="Alide_0008"
FT   CDS_pept        complement(9027..10049)
FT                   /locus_tag="Alide_0008"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2140"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2140 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760746"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102031"
FT                   "
FT                   /protein_id="YP_004124683.1"
FT   sig_peptide     complement(9945..10049)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.772 at
FT                   residue 35"
FT                   /locus_tag="Alide_0008"
FT   misc_feature    complement(9042..9863)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0008"
FT   gene            complement(10084..11856)
FT                   /db_xref="GeneID:10102032"
FT                   /locus_tag="Alide_0009"
FT   CDS_pept        complement(10084..11856)
FT                   /locus_tag="Alide_0009"
FT                   /gene_family="HOG000258966" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reh:H16_A2141 hypothetical protein"
FT                   /db_xref="GI:319760747"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="GeneID:10102032"
FT                   LLDMEIDCPEDLAP"
FT                   /protein_id="YP_004124684.1"
FT   misc_feature    complement(10768..11838)
FT                   /note="Protein of unknown function (DUF1446); Region:
FT                   DUF1446; pfam07287"
FT                   /db_xref="CDD:148728"
FT                   /locus_tag="Alide_0009"
FT   gene            complement(11853..13865)
FT                   /db_xref="GeneID:10102033"
FT                   /locus_tag="Alide_0010"
FT   CDS_pept        complement(11853..13865)
FT                   /locus_tag="Alide_0010"
FT                   /gene_family="HOG000008989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /codon_start="1"
FT                   /product="carbamoyl-phosphate synthase l chain ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   reh:H16_A2142 acetyl-CoA carboxylase alpha chain"
FT                   /db_xref="GI:319760748"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:10102033"
FT                   /protein_id="YP_004124685.1"
FT   misc_feature    complement(11880..13862)
FT                   /note="Acetyl/propionyl-CoA carboxylase, alpha subunit
FT                   [Lipid metabolism]; Region: COG4770"
FT                   /db_xref="CDD:34383"
FT                   /locus_tag="Alide_0010"
FT   misc_feature    complement(13533..13859)
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Alide_0010"
FT   misc_feature    complement(12903..13484)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Alide_0010"
FT   misc_feature    complement(12546..12860)
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Alide_0010"
FT   misc_feature    complement(11883..12080)
FT                   /note="The biotinyl-domain or biotin carboxyl carrier
FT                   protein (BCCP) domain is present in all biotin-dependent
FT                   enzymes, such as acetyl-CoA carboxylase, pyruvate
FT                   carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
FT                   carboxylase, geranyl-CoA carboxylase...; Region:
FT                   biotinyl_domain; cd06850"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Alide_0010"
FT   misc_feature    complement(order(11958..11960,11979..11987,12012..12014))
FT                   /note="carboxyltransferase (CT) interaction site; other
FT                   site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Alide_0010"
FT   misc_feature    complement(11982..11984)
FT                   /note="biotinylation site; other site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Alide_0010"
FT   gene            complement(13882..15045)
FT                   /db_xref="GeneID:10102034"
FT                   /locus_tag="Alide_0011"
FT   CDS_pept        complement(13882..15045)
FT                   /locus_tag="Alide_0011"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reh:H16_A2143 acyl-CoA dehydrogenase,
FT                   long-chain specific"
FT                   /db_xref="GI:319760749"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102034"
FT                   /protein_id="YP_004124686.1"
FT   misc_feature    complement(13891..15042)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0011"
FT   misc_feature    complement(13903..15033)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0011"
FT   misc_feature    complement(order(13939..13941,13945..13947,13951..13959,
FT                   14575..14577,14581..14583,14674..14676,14680..14682,
FT                   14770..14772))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0011"
FT   gene            complement(15177..16787)
FT                   /db_xref="GeneID:10102035"
FT                   /locus_tag="Alide_0012"
FT   CDS_pept        complement(15177..16787)
FT                   /locus_tag="Alide_0012"
FT                   /gene_family="HOG000218692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2144 propionyl-CoA carboxylase beta
FT                   chain; PFAM: carboxyl transferase"
FT                   /db_xref="GI:319760750"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="GeneID:10102035"
FT                   /product="methylcrotonoyl-CoA carboxylase"
FT                   /protein_id="YP_004124687.1"
FT   misc_feature    complement(15180..16748)
FT                   /note="3-methylcrotonyl-CoA carboxylase, beta chain;
FT                   Region: PLN02820"
FT                   /db_xref="CDD:178415"
FT                   /locus_tag="Alide_0012"
FT   misc_feature    complement(16107..>16550)
FT                   /note="Acetyl co-enzyme A carboxylase carboxyltransferase
FT                   alpha subunit; Region: ACCA; cl00513"
FT                   /db_xref="CDD:186049"
FT                   /locus_tag="Alide_0012"
FT   gene            complement(16899..17204)
FT                   /db_xref="GeneID:10102036"
FT                   /locus_tag="Alide_0013"
FT   CDS_pept        complement(16899..17204)
FT                   /locus_tag="Alide_0013"
FT                   /gene_family="HOG000292686" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /codon_start="1"
FT                   /product="acylphosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: acylphosphatase; KEGG: ajs:Ajs_4152
FT                   acylphosphatase"
FT                   /db_xref="GI:319760751"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="GeneID:10102036"
FT                   /protein_id="YP_004124688.1"
FT   misc_feature    complement(16944..17186)
FT                   /note="Acylphosphatase; Region: Acylphosphatase; cl00551"
FT                   /db_xref="CDD:186075"
FT                   /locus_tag="Alide_0013"
FT   gene            17232..17516
FT                   /db_xref="GeneID:10102037"
FT                   /locus_tag="Alide_0014"
FT   CDS_pept        17232..17516
FT                   /locus_tag="Alide_0014"
FT                   /gene_family="HOG000044611" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_4153"
FT                   /codon_start="1"
FT                   /product="4fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_4153 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="GI:319760752"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:10102037"
FT                   /protein_id="YP_004124689.1"
FT   misc_feature    17268..>17324
FT                   /note="4Fe-4S binding domain; Region: Fer4; pfam00037"
FT                   /db_xref="CDD:143826"
FT                   /locus_tag="Alide_0014"
FT   misc_feature    <17283..17459
FT                   /note="RPB11 and RPB3 subunits of RNA polymerase; Region:
FT                   RNAP_RPB11_RPB3; cl11409"
FT                   /db_xref="CDD:187025"
FT                   /locus_tag="Alide_0014"
FT   gene            17834..19219
FT                   /db_xref="GeneID:10102038"
FT                   /locus_tag="Alide_0015"
FT   CDS_pept        17834..19219
FT                   /locus_tag="Alide_0015"
FT                   /gene_family="HOG000076615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /codon_start="1"
FT                   /product="homoserine dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: ajs:Ajs_4155 homoserine
FT                   dehydrogenase"
FT                   /db_xref="GI:319760753"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="GeneID:10102038"
FT                   EYA"
FT                   /protein_id="YP_004124690.1"
FT   misc_feature    17921..18286
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0015"
FT   misc_feature    18323..18760
FT                   /note="Homoserine dehydrogenase; Region: Homoserine_dh;
FT                   pfam00742"
FT                   /db_xref="CDD:144371"
FT                   /locus_tag="Alide_0015"
FT   gene            19379..21553
FT                   /db_xref="GeneID:10102039"
FT                   /locus_tag="Alide_0016"
FT   CDS_pept        19379..21553
FT                   /locus_tag="Alide_0016"
FT                   /gene_family="HOG000242573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00491"
FT                   /codon_start="1"
FT                   /product="helicase c2"
FT                   /transl_table="11"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   ajs:Ajs_4158 ATP-dependent DNA helicase DinG"
FT                   /db_xref="GI:319760754"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="GeneID:10102039"
FT                   /protein_id="YP_004124691.1"
FT   misc_feature    19379..21547
FT                   /note="ATP-dependent DNA helicase DinG; Provisional;
FT                   Region: dinG; PRK11747"
FT                   /db_xref="CDD:183295"
FT                   /locus_tag="Alide_0016"
FT   misc_feature    19562..>19690
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Alide_0016"
FT   misc_feature    21140..21487
FT                   /note="helicase superfamily c-terminal domain; Region:
FT                   HELICc2; cl09250"
FT                   /db_xref="CDD:142194"
FT                   /locus_tag="Alide_0016"
FT   gene            21566..22195
FT                   /db_xref="GeneID:10102040"
FT                   /locus_tag="Alide_0017"
FT   CDS_pept        21566..22195
FT                   /locus_tag="Alide_0017"
FT                   /gene_family="HOG000258615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   KEGG: ajs:Ajs_4160 DNA polymerase III, epsilon subunit;
FT                   SMART: Exonuclease"
FT                   /db_xref="GI:319760755"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="GeneID:10102040"
FT                   /product="DNA-directed DNA polymerase"
FT                   /protein_id="YP_004124692.1"
FT   misc_feature    21581..22003
FT                   /note="DEDDh 3'-5' exonuclease domain family; Region:
FT                   DEDDh; cd06127"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Alide_0017"
FT   misc_feature    order(21590..21601,21605..21607,21833..21838,21842..21850)
FT                   /note="active site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Alide_0017"
FT   misc_feature    order(21590..21592,21596..21598,21848..21850)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Alide_0017"
FT   misc_feature    order(21590..21601,21605..21607,21833..21838,21842..21847)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Alide_0017"
FT   gene            22262..22741
FT                   /db_xref="GeneID:10102041"
FT                   /locus_tag="Alide_0018"
FT   CDS_pept        22262..22741
FT                   /locus_tag="Alide_0018"
FT                   /gene_family="HOG000229978" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /codon_start="1"
FT                   /product="nlp/p60 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLP/P60 protein; KEGG: ajs:Ajs_0001 NLP/P60
FT                   protein"
FT                   /db_xref="GI:319760756"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="GeneID:10102041"
FT                   /protein_id="YP_004124693.1"
FT   sig_peptide     22262..22342
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.479 at
FT                   residue 27"
FT                   /locus_tag="Alide_0018"
FT   misc_feature    22418..22735
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="Alide_0018"
FT   gene            22780..23883
FT                   /db_xref="GeneID:10102042"
FT                   /locus_tag="Alide_0019"
FT   CDS_pept        22780..23883
FT                   /locus_tag="Alide_0019"
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: ajs:Ajs_0002
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="GI:319760757"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="GeneID:10102042"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /protein_id="YP_004124694.1"
FT   misc_feature    22819..23844
FT                   /note="NeuB family; Region: NeuB; cl00496"
FT                   /db_xref="CDD:186036"
FT                   /locus_tag="Alide_0019"
FT   misc_feature    22951..23838
FT                   /note="DAHP synthetase I family; Region: DAHP_synth_1;
FT                   pfam00793"
FT                   /db_xref="CDD:144404"
FT                   /locus_tag="Alide_0019"
FT   gene            24476..28096
FT                   /db_xref="GeneID:10102043"
FT                   /locus_tag="Alide_0020"
FT   CDS_pept        24476..28096
FT                   /locus_tag="Alide_0020"
FT                   /gene_family="HOG000224875" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   GAF domain protein; PAS fold domain protein; KEGG:
FT                   dia:Dtpsy_0021 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s); SMART: EAL domain protein; GGDEF
FT                   domain containing protein; PAS domain containing protein;
FT                   PAC repeat-containing protein; GAF domain protein"
FT                   /db_xref="GI:319760758"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:10102043"
FT                   /protein_id="YP_004124695.1"
FT   misc_feature    24998..25381
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    25004..25177
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    25403..25882
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    26420..26767
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    26435..26737
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    order(26483..26485,26495..26497,26513..26515,26552..26563,
FT                   26633..26635,26648..26650)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    order(26543..26545,26555..26557,26576..26578,26585..26590,
FT                   26669..26671,26675..26677)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    26780..27271
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    order(26891..26893,27020..27022)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    order(26906..26908,26915..26920,26930..26932,26942..26944,
FT                   27008..27010,27014..27025)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    order(26996..26998,27098..27100)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0020"
FT   misc_feature    27323..28030
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Alide_0020"
FT   gene            complement(28163..28966)
FT                   /db_xref="GeneID:10102044"
FT                   /locus_tag="Alide_0021"
FT   CDS_pept        complement(28163..28966)
FT                   /locus_tag="Alide_0021"
FT                   /gene_family="HOG000256786" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0022 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760759"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102044"
FT                   /protein_id="YP_004124696.1"
FT   misc_feature    complement(28640..28912)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0021"
FT   misc_feature    complement(28178..28909)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Alide_0021"
FT   misc_feature    complement(28214..28564)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Alide_0021"
FT   gene            29153..30124
FT                   /db_xref="GeneID:10102045"
FT                   /locus_tag="Alide_0022"
FT   CDS_pept        29153..30124
FT                   /locus_tag="Alide_0022"
FT                   /gene_family="HOG000126605" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0005"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0005 hypothetical protein"
FT                   /db_xref="GI:319760760"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102045"
FT                   /protein_id="YP_004124697.1"
FT   sig_peptide     29153..29233
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.889 at
FT                   residue 27"
FT                   /locus_tag="Alide_0022"
FT   misc_feature    29303..30115
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0022"
FT   gene            complement(30135..31163)
FT                   /db_xref="GeneID:10102046"
FT                   /locus_tag="Alide_0023"
FT   CDS_pept        complement(30135..31163)
FT                   /locus_tag="Alide_0023"
FT                   /gene_family="HOG000131661" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bpt:Bpet3280 hypothetical protein"
FT                   /db_xref="GI:319760761"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102046"
FT                   LP"
FT                   /protein_id="YP_004124698.1"
FT   misc_feature    complement(<30879..31154)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0023"
FT   misc_feature    complement(30207..>30527)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0023"
FT   gene            complement(31168..32355)
FT                   /db_xref="GeneID:10102047"
FT                   /locus_tag="Alide_0024"
FT   CDS_pept        complement(31168..32355)
FT                   /locus_tag="Alide_0024"
FT                   /gene_family="HOG000131668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bpt:Bpet3281 acyl-CoA dehydrogenase"
FT                   /db_xref="GI:319760762"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102047"
FT                   /protein_id="YP_004124699.1"
FT   misc_feature    complement(31177..32349)
FT                   /note="pimeloyl-CoA dehydrogenase, large subunit; Region:
FT                   pimC_large; TIGR03204"
FT                   /db_xref="CDD:132248"
FT                   /locus_tag="Alide_0024"
FT   misc_feature    complement(31180..32334)
FT                   /note="Putative acyl-CoA dehydrogenases similar to fadE6,
FT                   fadE17, and fadE26; Region: ACAD_fadE6_17_26; cd01152"
FT                   /db_xref="CDD:173841"
FT                   /locus_tag="Alide_0024"
FT   misc_feature    complement(order(31870..31872,31876..31878,31948..31953,
FT                   31966..31971,31975..31977))
FT                   /note="FAD binding site; other site"
FT                   /db_xref="CDD:173841"
FT                   /locus_tag="Alide_0024"
FT   misc_feature    complement(order(31192..31194,31225..31230,31804..31806,
FT                   31948..31950))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173841"
FT                   /locus_tag="Alide_0024"
FT   misc_feature    complement(31621..31623)
FT                   /note="catalytic base; other site"
FT                   /db_xref="CDD:173841"
FT                   /locus_tag="Alide_0024"
FT   gene            complement(32402..33367)
FT                   /db_xref="GeneID:10102048"
FT                   /locus_tag="Alide_0025"
FT   CDS_pept        complement(32402..33367)
FT                   /locus_tag="Alide_0025"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bpet3282"
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpt:Bpet3282 secreted protein"
FT                   /db_xref="GI:319760763"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102048"
FT                   /protein_id="YP_004124700.1"
FT   sig_peptide     complement(33299..33367)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT                   /locus_tag="Alide_0025"
FT   misc_feature    complement(32414..33235)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0025"
FT   gene            complement(33405..35498)
FT                   /db_xref="GeneID:10102049"
FT                   /locus_tag="Alide_0026"
FT   CDS_pept        complement(33405..35498)
FT                   /locus_tag="Alide_0026"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02222"
FT                   /codon_start="1"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; CoA-binding domain protein; KEGG:
FT                   rme:Rmet_0842 CoA-binding"
FT                   /db_xref="GI:319760764"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:10102049"
FT                   SGQ"
FT                   /protein_id="YP_004124701.1"
FT   misc_feature    complement(34155..35483)
FT                   /note="acetyl coenzyme A synthetase (ADP forming), alpha
FT                   domain; Region: AcCoA-syn-alpha; TIGR02717"
FT                   /db_xref="CDD:131764"
FT                   /locus_tag="Alide_0026"
FT   misc_feature    complement(<35211..35474)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0026"
FT   misc_feature    complement(<33408..33956)
FT                   /note="Acyl-CoA synthetase (NDP forming) [Energy production
FT                   and conversion]; Region: COG1042"
FT                   /db_xref="CDD:31244"
FT                   /locus_tag="Alide_0026"
FT   gene            complement(35513..36313)
FT                   /db_xref="GeneID:10102050"
FT                   /locus_tag="Alide_0027"
FT   CDS_pept        complement(35513..36313)
FT                   /locus_tag="Alide_0027"
FT                   /gene_family="HOG000027943" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rme:Rmet_0841 enoyl-CoA hydratase"
FT                   /db_xref="GI:319760765"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102050"
FT                   /protein_id="YP_004124702.1"
FT   misc_feature    complement(35708..36298)
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0027"
FT   misc_feature    complement(order(35900..35902,35903..35905,35969..35977,
FT                   35981..35983,36113..36127,36137..36139,36233..36235,
FT                   36239..36241))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0027"
FT   misc_feature    complement(order(35969..35971,36119..36121))
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0027"
FT   misc_feature    complement(order(35708..35713,35720..35722,35765..35767,
FT                   35774..35776,35807..35809,35816..35821,35825..35830,
FT                   35834..35839,35852..35857,35867..35875,35879..35881,
FT                   35897..35902,35933..35944,36005..36007,36038..36040))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0027"
FT   gene            36408..37172
FT                   /db_xref="GeneID:10102051"
FT                   /locus_tag="Alide_0028"
FT   CDS_pept        36408..37172
FT                   /locus_tag="Alide_0028"
FT                   /gene_family="HOG000142058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: bpt:Bpet3285 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760766"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102051"
FT                   /protein_id="YP_004124703.1"
FT   misc_feature    36483..37139
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Alide_0028"
FT   misc_feature    36483..36710
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0028"
FT   gene            complement(37432..38037)
FT                   /db_xref="GeneID:10102052"
FT                   /locus_tag="Alide_0029"
FT   CDS_pept        complement(37432..38037)
FT                   /locus_tag="Alide_0029"
FT                   /gene_family="HOG000224876" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09411"
FT                   /codon_start="1"
FT                   /product="lipid a 3-o-deacylase-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Lipid A 3-O-deacylase-related; KEGG:
FT                   dia:Dtpsy_0024 hypothetical protein"
FT                   /db_xref="GI:319760767"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="GeneID:10102052"
FT                   /protein_id="YP_004124704.1"
FT   sig_peptide     complement(37915..38037)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.981 at
FT                   residue 41"
FT                   /locus_tag="Alide_0029"
FT   misc_feature    complement(37435..37866)
FT                   /note="Lipid A 3-O-deacylase (PagL); Region: PagL;
FT                   pfam09411"
FT                   /db_xref="CDD:150172"
FT                   /locus_tag="Alide_0029"
FT   gene            complement(38152..38745)
FT                   /db_xref="GeneID:10102053"
FT                   /locus_tag="Alide_0030"
FT   CDS_pept        complement(38152..38745)
FT                   /locus_tag="Alide_0030"
FT                   /gene_family="HOG000220307" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0007"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0007 hypothetical protein"
FT                   /db_xref="GI:319760768"
FT                   /db_xref="GeneID:10102053"
FT                   /protein_id="YP_004124705.1"
FT   sig_peptide     complement(38659..38745)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT                   /locus_tag="Alide_0030"
FT   misc_feature    complement(38296..38568)
FT                   /note="Domain of Unknown Function (DUF1520); Region:
FT                   DUF1520; pfam07480"
FT                   /db_xref="CDD:148852"
FT                   /locus_tag="Alide_0030"
FT   gene            38962..39903
FT                   /db_xref="GeneID:10102054"
FT                   /locus_tag="Alide_0031"
FT   CDS_pept        38962..39903
FT                   /locus_tag="Alide_0031"
FT                   /gene_family="HOG000117544" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /codon_start="1"
FT                   /product="exonuclease rdgc"
FT                   /transl_table="11"
FT                   /note="PFAM: exonuclease RdgC; KEGG: ajs:Ajs_0008
FT                   recombination associated protein"
FT                   /db_xref="GI:319760769"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="GeneID:10102054"
FT                   /protein_id="YP_004124706.1"
FT   misc_feature    38962..39852
FT                   /note="Putative exonuclease, RdgC; Region: RdgC; cl01122"
FT                   /db_xref="CDD:186346"
FT                   /locus_tag="Alide_0031"
FT   gene            39923..41176
FT                   /db_xref="GeneID:10102055"
FT                   /locus_tag="Alide_0032"
FT   CDS_pept        39923..41176
FT                   /locus_tag="Alide_0032"
FT                   /gene_family="HOG000290821" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /codon_start="1"
FT                   /product="nucleoside recognition domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ajs:Ajs_0012 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="GI:319760770"
FT                   /db_xref="GO:0001882"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="GeneID:10102055"
FT                   ADAVGLIAAIGVGYAMLR"
FT                   /protein_id="YP_004124707.1"
FT   misc_feature    40004..40531
FT                   /note="Uncharacterized membrane protein, required for spore
FT                   maturation in B.subtilis. [General function prediction
FT                   only]; Region: SpmA; COG2715"
FT                   /db_xref="CDD:32608"
FT                   /locus_tag="Alide_0032"
FT   misc_feature    40712..41170
FT                   /note="Nucleoside recognition; Region: Gate; cl00486"
FT                   /db_xref="CDD:186029"
FT                   /locus_tag="Alide_0032"
FT   gene            41657..41908
FT                   /db_xref="GeneID:10102056"
FT                   /locus_tag="Alide_0033"
FT   CDS_pept        41657..41908
FT                   /locus_tag="Alide_0033"
FT                   /gene_family="HOG000280481" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0031 hypothetical protein"
FT                   /db_xref="GI:319760771"
FT                   /db_xref="GeneID:10102056"
FT                   /protein_id="YP_004124708.1"
FT   misc_feature    41684..41902
FT                   /note="Protein of unknown function (DUF3297); Region:
FT                   DUF3297; pfam11730"
FT                   /db_xref="CDD:152166"
FT                   /locus_tag="Alide_0033"
FT   gene            complement(41877..43754)
FT                   /db_xref="GeneID:10102057"
FT                   /locus_tag="Alide_0034"
FT   CDS_pept        complement(41877..43754)
FT                   /locus_tag="Alide_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Balat_0053"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: blt:Balat_0053 beta-galactosidase I"
FT                   /db_xref="GI:319760772"
FT                   /db_xref="GeneID:10102057"
FT                   /protein_id="YP_004124709.1"
FT   sig_peptide     complement(43683..43754)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.974 at
FT                   residue 24"
FT                   /locus_tag="Alide_0034"
FT   misc_feature    complement(<43143..43604)
FT                   /note="Beta-galactosidase; Region: Glyco_hydro_42; cl03154"
FT                   /db_xref="CDD:155315"
FT                   /locus_tag="Alide_0034"
FT   gene            complement(43852..44289)
FT                   /db_xref="GeneID:10102058"
FT                   /locus_tag="Alide_0035"
FT   CDS_pept        complement(43852..44289)
FT                   /locus_tag="Alide_0035"
FT                   /gene_family="HOG000266076" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /codon_start="1"
FT                   /product="cu(i)-responsive transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; KEGG: dia:Dtpsy_0035 transcriptional
FT                   regulator, MerR family; SMART: regulatory protein MerR"
FT                   /db_xref="GI:319760773"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="GeneID:10102058"
FT                   /protein_id="YP_004124710.1"
FT   misc_feature    complement(43870..44244)
FT                   /note="Cu(I)-responsive transcriptional regulator; Region:
FT                   CueR; TIGR02044"
FT                   /db_xref="CDD:131099"
FT                   /locus_tag="Alide_0035"
FT   misc_feature    complement(43870..44244)
FT                   /note="Helix-Turn-Helix DNA binding domain of CueR-like
FT                   transcription regulators; Region: HTH_CueR; cd01108"
FT                   /db_xref="CDD:133383"
FT                   /locus_tag="Alide_0035"
FT   misc_feature    complement(order(44140..44148,44197..44199,44239..44244))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133383"
FT                   /locus_tag="Alide_0035"
FT   misc_feature    complement(order(43873..43878,43885..43887,43891..43893,
FT                   43897..43911,43924..43926,43945..43950,43957..43959,
FT                   43969..43971,43987..43989,43999..44001,44008..44010,
FT                   44017..44022,44041..44043,44053..44055,44080..44085,
FT                   44095..44097,44104..44106))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133383"
FT                   /locus_tag="Alide_0035"
FT   misc_feature    complement(order(43891..43893,43915..43917,44020..44022))
FT                   /note="copper binding site; other site"
FT                   /db_xref="CDD:133383"
FT                   /locus_tag="Alide_0035"
FT   gene            complement(44286..44483)
FT                   /db_xref="GeneID:10102059"
FT                   /locus_tag="Alide_0036"
FT   CDS_pept        complement(44286..44483)
FT                   /locus_tag="Alide_0036"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /codon_start="1"
FT                   /product="heavy metal transport/detoxification protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: dia:Dtpsy_0036 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="GI:319760774"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="GeneID:10102059"
FT                   /protein_id="YP_004124711.1"
FT   misc_feature    complement(44289..44483)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cl00207"
FT                   /db_xref="CDD:163733"
FT                   /locus_tag="Alide_0036"
FT   gene            44653..46884
FT                   /db_xref="GeneID:10102060"
FT                   /locus_tag="Alide_0037"
FT   CDS_pept        44653..46884
FT                   /locus_tag="Alide_0037"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /codon_start="1"
FT                   /product="heavy metal translocating p-type atpase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0037 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:319760775"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001756"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:10102060"
FT                   /protein_id="YP_004124712.1"
FT   misc_feature    44692..46878
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="Alide_0037"
FT   misc_feature    44698..>44805
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Alide_0037"
FT   misc_feature    order(44716..44724,44731..44733)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Alide_0037"
FT   misc_feature    45250..45909
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Alide_0037"
FT   misc_feature    46339..>46488
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Alide_0037"
FT   misc_feature    46408..46410
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Alide_0037"
FT   gene            47011..48660
FT                   /db_xref="GeneID:10102061"
FT                   /locus_tag="Alide_0038"
FT   CDS_pept        47011..48660
FT                   /locus_tag="Alide_0038"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0020 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:319760776"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="GeneID:10102061"
FT                   /protein_id="YP_004124713.1"
FT   misc_feature    47443..48477
FT                   /note="Methyl-accepting chemotaxis protein [Cell motility
FT                   and secretion / Signal transduction mechanisms]; Region:
FT                   Tar; COG0840"
FT                   /db_xref="CDD:31182"
FT                   /locus_tag="Alide_0038"
FT   misc_feature    47602..47805
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="Alide_0038"
FT   misc_feature    47974..48567
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Alide_0038"
FT   gene            complement(48816..51911)
FT                   /db_xref="GeneID:10102062"
FT                   /locus_tag="Alide_0039"
FT   CDS_pept        complement(48816..51911)
FT                   /locus_tag="Alide_0039"
FT                   /gene_family="HOG000126203" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump, czca family"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0038 CzcA family heavy metal efflux
FT                   protein; TIGRFAM: heavy metal efflux pump, CzcA family;
FT                   PFAM: acriflavin resistance protein"
FT                   /db_xref="GI:319760777"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:10102062"
FT                   /protein_id="YP_004124714.1"
FT   misc_feature    complement(48942..51911)
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="Alide_0039"
FT   gene            complement(51908..53161)
FT                   /db_xref="GeneID:10102063"
FT                   /locus_tag="Alide_0040"
FT   CDS_pept        complement(51908..53161)
FT                   /locus_tag="Alide_0040"
FT                   /gene_family="HOG000224880" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, rnd family, mfp subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: aav:Aave_0039 RND family efflux transporter
FT                   MFP subunit"
FT                   /db_xref="GI:319760778"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:10102063"
FT                   EASSTGSEAKAQPAKETP"
FT                   /protein_id="YP_004124715.1"
FT   sig_peptide     complement(53054..53161)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.540 at
FT                   residue 36"
FT                   /locus_tag="Alide_0040"
FT   misc_feature    complement(51989..52900)
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="Alide_0040"
FT   gene            complement(53193..54434)
FT                   /db_xref="GeneID:10102064"
FT                   /locus_tag="Alide_0041"
FT   CDS_pept        complement(53193..54434)
FT                   /locus_tag="Alide_0041"
FT                   /gene_family="HOG000224881" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   aav:Aave_0040 outer membrane efflux protein"
FT                   /db_xref="GI:319760779"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:10102064"
FT                   GNWLLRTEPQLLLP"
FT                   /protein_id="YP_004124716.1"
FT   gene            54567..55292
FT                   /db_xref="GeneID:10102065"
FT                   /locus_tag="Alide_0042"
FT   CDS_pept        54567..55292
FT                   /locus_tag="Alide_0042"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="response regulator receiver"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0041 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="GI:319760780"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:10102065"
FT                   /protein_id="YP_004124717.1"
FT   misc_feature    54567..55265
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    54576..54950
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    order(54585..54590,54717..54719,54738..54740,54837..54839,
FT                   54894..54896,54903..54908)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    54717..54719
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    order(54726..54731,54732..54740)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    54903..54911
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    54984..55253
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Alide_0042"
FT   misc_feature    order(55050..55052,55107..55112,55164..55166,55173..55175,
FT                   55197..55202,55227..55229,55242..55244)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Alide_0042"
FT   gene            55289..56716
FT                   /db_xref="GeneID:10102066"
FT                   /locus_tag="Alide_0043"
FT   CDS_pept        55289..56716
FT                   /locus_tag="Alide_0043"
FT                   /gene_family="HOG000223178" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="ATP-binding region atpase domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0042 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; Two-component sensor kinase
FT                   domain-containing protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="GI:319760781"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="GeneID:10102066"
FT                   CARLVFAPLASTPGGEN"
FT                   /protein_id="YP_004124718.1"
FT   misc_feature    55328..56632
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    55364..55774
FT                   /note="Two-component sensor kinase N-terminal; Region:
FT                   2CSK_N; pfam08521"
FT                   /db_xref="CDD:149540"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    56006..56176
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    order(56021..56023,56033..56035,56045..56047,56054..56056,
FT                   56066..56068,56075..56077,56123..56125,56135..56137,
FT                   56144..56146,56156..56158,56165..56167)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    56039..56041
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    56357..56680
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    order(56375..56377,56387..56389,56396..56398,56477..56479,
FT                   56483..56485,56489..56491,56495..56500,56576..56587,
FT                   56633..56635,56639..56641,56657..56662,56666..56668)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    56387..56389
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0043"
FT   misc_feature    order(56489..56491,56495..56497,56576..56578,56582..56584)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0043"
FT   gene            complement(56742..57857)
FT                   /db_xref="GeneID:10102067"
FT                   /locus_tag="Alide_0044"
FT   CDS_pept        complement(56742..57857)
FT                   /locus_tag="Alide_0044"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /codon_start="1"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   dia:Dtpsy_0040 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="GI:319760782"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="GeneID:10102067"
FT                   /protein_id="YP_004124719.1"
FT   misc_feature    complement(56745..57857)
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family [Energy production and conversion]; Region: NemA;
FT                   COG1902"
FT                   /db_xref="CDD:32086"
FT                   /locus_tag="Alide_0044"
FT   misc_feature    complement(56802..57851)
FT                   /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE
FT                   was the first flavin-dependent enzyme identified, however
FT                   its true physiological role remains elusive to this day.
FT                   Each monomer of OYE contains FMN as a non-covalently bound
FT                   cofactor, uses NADPH as a...; Region: OYE_like_FMN;
FT                   cd02933"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Alide_0044"
FT   misc_feature    complement(order(56868..56876,56880..56882,56940..56942,
FT                   57162..57164,57567..57569,57693..57695,57783..57785,
FT                   57789..57791))
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Alide_0044"
FT   misc_feature    complement(order(56871..56876,56880..56882,56940..56942,
FT                   57141..57143,57162..57164,57303..57305,57309..57311,
FT                   57318..57320,57540..57542,57561..57563,57567..57569,
FT                   57693..57695,57783..57785,57789..57791))
FT                   /note="active site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Alide_0044"
FT   misc_feature    complement(order(56871..56873,57303..57305,57309..57311,
FT                   57318..57320,57561..57563,57783..57785))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Alide_0044"
FT   misc_feature    complement(57303..57305)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Alide_0044"
FT   gene            complement(57920..58528)
FT                   /db_xref="GeneID:10102068"
FT                   /locus_tag="Alide_0045"
FT   CDS_pept        complement(57920..58528)
FT                   /locus_tag="Alide_0045"
FT                   /gene_family="HOG000125748" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="glutathione s-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dia:Dtpsy_0042 glutathione S-transferase domain protein"
FT                   /db_xref="GI:319760783"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="GeneID:10102068"
FT                   /protein_id="YP_004124720.1"
FT   misc_feature    complement(57929..58528)
FT                   /note="glutathionine S-transferase; Provisional; Region:
FT                   PRK10542"
FT                   /db_xref="CDD:182533"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(58295..58528)
FT                   /note="GST_N family, Class Beta subfamily; GSTs are
FT                   cytosolic dimeric proteins involved in cellular
FT                   detoxification by catalyzing the conjugation of glutathione
FT                   (GSH) with a wide range of endogenous and xenobiotic
FT                   alkylating agents, including carcinogens...; Region:
FT                   GST_N_Beta; cd03057"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(order(58304..58306,58316..58318,58469..58474,
FT                   58484..58486,58490..58492,58505..58510))
FT                   /note="C-terminal domain interface; other site"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(order(58331..58336,58373..58378,58499..58501))
FT                   /note="GSH binding site (G-site); other site"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(order(58304..58306,58313..58315,58328..58330,
FT                   58334..58339,58376..58378))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(57944..58264)
FT                   /note="GST_C family, Class Beta subfamily; GSTs are
FT                   cytosolic dimeric proteins involved in cellular
FT                   detoxification by catalyzing the conjugation of glutathione
FT                   (GSH) with a wide range of endogenous and xenobiotic
FT                   alkylating agents, including carcinogens...; Region:
FT                   GST_C_Beta; cd03188"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(order(58145..58147,58157..58159,58166..58168,
FT                   58181..58183,58208..58210,58220..58222,58232..58234,
FT                   58241..58243,58250..58255,58262..58264))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(order(57947..57949,57959..57961,57965..57967,
FT                   58037..58039,58049..58051,58070..58072,58211..58213,
FT                   58256..58258))
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0045"
FT   misc_feature    complement(order(58028..58030,58037..58039,58046..58048,
FT                   58190..58192,58196..58201,58208..58213,58223..58225))
FT                   /note="substrate binding pocket (H-site); other site"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0045"
FT   gene            complement(58561..58857)
FT                   /db_xref="GeneID:10102069"
FT                   /locus_tag="Alide_0046"
FT   CDS_pept        complement(58561..58857)
FT                   /locus_tag="Alide_0046"
FT                   /gene_family="HOG000257225" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dia:Dtpsy_0043 protein of unknown function UPF0153"
FT                   /db_xref="GI:319760784"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="GeneID:10102069"
FT                   /protein_id="YP_004124721.1"
FT   gene            complement(58864..59442)
FT                   /db_xref="GeneID:10102070"
FT                   /locus_tag="Alide_0047"
FT   CDS_pept        complement(58864..59442)
FT                   /locus_tag="Alide_0047"
FT                   /gene_family="HOG000263119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /codon_start="1"
FT                   /product="nadph-dependent fmn reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dia:Dtpsy_0044 NADPH-dependent FMN reductase"
FT                   /db_xref="GI:319760785"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="GeneID:10102070"
FT                   /protein_id="YP_004124722.1"
FT   misc_feature    complement(58969..59442)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:185997"
FT                   /locus_tag="Alide_0047"
FT   gene            59574..61553
FT                   /db_xref="GeneID:10102071"
FT                   /locus_tag="Alide_0048"
FT   CDS_pept        59574..61553
FT                   /locus_tag="Alide_0048"
FT                   /gene_family="HOG000201060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /codon_start="1"
FT                   /product="glucose inhibited division protein a"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: glucose inhibited
FT                   division protein A; KEGG: dia:Dtpsy_0045 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="GI:319760786"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="GeneID:10102071"
FT                   /protein_id="YP_004124723.1"
FT   misc_feature    59580..61511
FT                   /note="NAD(FAD)-utilizing enzyme possibly involved in
FT                   translation [Translation, ribosomal structure and
FT                   biogenesis]; Region: Gid; cl11520"
FT                   /db_xref="CDD:187089"
FT                   /locus_tag="Alide_0048"
FT   misc_feature    59580..61502
FT                   /note="Flavin-dependent tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA [Cell
FT                   cycle control, cell division, chromosome partitioning];
FT                   Region: GidA; COG0445"
FT                   /db_xref="CDD:30794"
FT                   /locus_tag="Alide_0048"
FT   gene            61537..61776
FT                   /db_xref="GeneID:10102072"
FT                   /locus_tag="Alide_0049"
FT   CDS_pept        61537..61776
FT                   /locus_tag="Alide_0049"
FT                   /gene_family="HOG000272151" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PC1_0787"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pct:PC1_0787 hypothetical protein"
FT                   /db_xref="GI:319760787"
FT                   /db_xref="GeneID:10102072"
FT                   /protein_id="YP_004124724.1"
FT   gene            61769..62416
FT                   /db_xref="GeneID:10102073"
FT                   /locus_tag="Alide_0050"
FT   CDS_pept        61769..62416
FT                   /locus_tag="Alide_0050"
FT                   /gene_family="HOG000221012" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /codon_start="1"
FT                   /product="methyltransferase gidb"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0046 16S rRNA methyltransferase
FT                   GidB; TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="GI:319760788"
FT                   /db_xref="GO:0008649"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="GeneID:10102073"
FT                   /protein_id="YP_004124725.1"
FT   misc_feature    61838..62410
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Alide_0050"
FT   gene            62453..63067
FT                   /db_xref="GeneID:10102074"
FT                   /locus_tag="Alide_0051"
FT   CDS_pept        62453..63067
FT                   /locus_tag="Alide_0051"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /codon_start="1"
FT                   /product="lysine exporter protein (lyse/ygga)"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   dia:Dtpsy_0047 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="GI:319760789"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:10102074"
FT                   /protein_id="YP_004124726.1"
FT   misc_feature    62453..63061
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:186083"
FT                   /locus_tag="Alide_0051"
FT   gene            63076..63846
FT                   /db_xref="GeneID:10102075"
FT                   /locus_tag="Alide_0052"
FT   CDS_pept        63076..63846
FT                   /locus_tag="Alide_0052"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0048"
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0048 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="GI:319760790"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="GeneID:10102075"
FT                   /protein_id="YP_004124727.1"
FT   misc_feature    63076..63840
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Alide_0052"
FT   misc_feature    63085..>63201
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0052"
FT   misc_feature    63106..63126
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0052"
FT   misc_feature    63124..63126
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0052"
FT   misc_feature    63370..63621
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0052"
FT   misc_feature    63448..63450
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0052"
FT   gene            63931..64473
FT                   /db_xref="GeneID:10102076"
FT                   /locus_tag="Alide_0053"
FT   CDS_pept        63931..64473
FT                   /locus_tag="Alide_0053"
FT                   /gene_family="HOG000140046" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   ajs:Ajs_0030 hypothetical protein"
FT                   /db_xref="GI:319760791"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="GeneID:10102076"
FT                   GDWPEGHALLQTLINKD"
FT                   /protein_id="YP_004124728.1"
FT   misc_feature    63946..64452
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Alide_0053"
FT   gene            64479..65396
FT                   /db_xref="GeneID:10102077"
FT                   /locus_tag="Alide_0054"
FT   CDS_pept        64479..65396
FT                   /locus_tag="Alide_0054"
FT                   /gene_family="HOG000088074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /codon_start="1"
FT                   /product="parb-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: aav:Aave_0056 chromosome
FT                   segregation DNA-binding protein; SMART: ParB domain protein
FT                   nuclease"
FT                   /db_xref="GI:319760792"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:10102077"
FT                   /protein_id="YP_004124729.1"
FT   misc_feature    64584..65090
FT                   /note="ParB-like partition proteins; Region: parB_part;
FT                   TIGR00180"
FT                   /db_xref="CDD:161748"
FT                   /locus_tag="Alide_0054"
FT   misc_feature    64593..64871
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Alide_0054"
FT   gene            65421..66200
FT                   /db_xref="GeneID:10102078"
FT                   /locus_tag="Alide_0055"
FT   CDS_pept        65421..66200
FT                   /locus_tag="Alide_0055"
FT                   /gene_family="HOG000224884" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0032"
FT                   /codon_start="1"
FT                   /product="methyltransferase type 12"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0032 methyltransferase type 12"
FT                   /db_xref="GI:319760793"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="GeneID:10102078"
FT                   /protein_id="YP_004124730.1"
FT   sig_peptide     65421..65486
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.639) with cleavage site probability 0.636 at
FT                   residue 22"
FT                   /locus_tag="Alide_0055"
FT   gene            66260..67300
FT                   /db_xref="GeneID:10102079"
FT                   /locus_tag="Alide_0056"
FT   CDS_pept        66260..67300
FT                   /locus_tag="Alide_0056"
FT                   /gene_family="HOG000123847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /codon_start="1"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   dia:Dtpsy_0052 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="GI:319760794"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="GeneID:10102079"
FT                   AGALSR"
FT                   /protein_id="YP_004124731.1"
FT   sig_peptide     66260..66319
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.716 at
FT                   residue 20"
FT                   /locus_tag="Alide_0056"
FT   misc_feature    67133..67291
FT                   /note="Putative peptidoglycan binding domain; Region:
FT                   PG_binding_1; pfam01471"
FT                   /db_xref="CDD:144895"
FT                   /locus_tag="Alide_0056"
FT   gene            complement(67380..68285)
FT                   /db_xref="GeneID:10102080"
FT                   /locus_tag="Alide_0057"
FT   CDS_pept        complement(67380..68285)
FT                   /locus_tag="Alide_0057"
FT                   /gene_family="HOG000111165" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00342"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix, arac domain protein"
FT                   /transl_table="11"
FT                   /note="SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   dia:Dtpsy_0054 transcriptional regulator, AraC family"
FT                   /db_xref="GI:319760795"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:10102080"
FT                   /protein_id="YP_004124732.1"
FT   misc_feature    complement(67818..68129)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Alide_0057"
FT   misc_feature    complement(67392..67742)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Alide_0057"
FT   gene            68345..69610
FT                   /db_xref="GeneID:10102081"
FT                   /locus_tag="Alide_0058"
FT   CDS_pept        68345..69610
FT                   /locus_tag="Alide_0058"
FT                   /gene_family="HOG000220023" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dia:Dtpsy_0055 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:319760796"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102081"
FT                   /protein_id="YP_004124733.1"
FT   misc_feature    <69005..69508
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Alide_0058"
FT   gene            complement(69612..70421)
FT                   /db_xref="GeneID:10102082"
FT                   /locus_tag="Alide_0059"
FT   CDS_pept        complement(69612..70421)
FT                   /locus_tag="Alide_0059"
FT                   /gene_family="HOG000110051" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /codon_start="1"
FT                   /product="mscs mechanosensitive ion channel"
FT                   /transl_table="11"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bpy:Bphyt_0752 MscS mechanosensitive ion channel"
FT                   /db_xref="GI:319760797"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="GeneID:10102082"
FT                   /protein_id="YP_004124734.1"
FT   misc_feature    complement(69642..>70106)
FT                   /note="Mechanosensitive ion channel; Region: MS_channel;
FT                   pfam00924"
FT                   /db_xref="CDD:144501"
FT                   /locus_tag="Alide_0059"
FT   gene            70500..70595
FT                   /db_xref="GeneID:10102083"
FT                   /locus_tag="Alide_0060"
FT   CDS_pept        70500..70595
FT                   /locus_tag="Alide_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:319760798"
FT                   /db_xref="GeneID:10102083"
FT                   /translation="MAVPMSGPAATRHTVLQEKASNALCMGAISY"
FT                   /protein_id="YP_004124735.1"
FT   gene            complement(70620..72044)
FT                   /db_xref="GeneID:10102084"
FT                   /locus_tag="Alide_0061"
FT   CDS_pept        complement(70620..72044)
FT                   /locus_tag="Alide_0061"
FT                   /gene_family="HOG000230995" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="fad linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ajs:Ajs_0040 fis family transcriptional regulator"
FT                   /db_xref="GI:319760799"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="GeneID:10102084"
FT                   ALDPKNILNPGKIFAL"
FT                   /protein_id="YP_004124736.1"
FT   misc_feature    complement(70632..71990)
FT                   /note="D-lactate dehydrogenase [cytochrome]; Region:
FT                   PLN02805"
FT                   /db_xref="CDD:178402"
FT                   /locus_tag="Alide_0061"
FT   misc_feature    complement(71463..71876)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Alide_0061"
FT   gene            complement(72821..73033)
FT                   /db_xref="GeneID:10102085"
FT                   /locus_tag="Alide_0062"
FT   CDS_pept        complement(72821..73033)
FT                   /locus_tag="Alide_0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Shel_23880"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shi:Shel_23880 hypothetical protein"
FT                   /db_xref="GI:319760800"
FT                   /db_xref="GeneID:10102085"
FT                   /protein_id="YP_004124737.1"
FT   gene            complement(73036..73581)
FT                   /db_xref="GeneID:10102086"
FT                   /locus_tag="Alide_0063"
FT   CDS_pept        complement(73036..73581)
FT                   /locus_tag="Alide_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_2099"
FT                   /codon_start="1"
FT                   /product="phage virion morphogenesis protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rsq:Rsph17025_2099 phage virion morphogenesis
FT                   protein"
FT                   /db_xref="GI:319760801"
FT                   /db_xref="GeneID:10102086"
FT                   QTGRENVVSLVRSYFLEG"
FT                   /protein_id="YP_004124738.1"
FT   misc_feature    complement(73048..73542)
FT                   /note="Phage virion morphogenesis family; Region:
FT                   Phage_tail_S; cl02089"
FT                   /db_xref="CDD:154737"
FT                   /locus_tag="Alide_0063"
FT   gene            complement(73688..74890)
FT                   /db_xref="GeneID:10102087"
FT                   /locus_tag="Alide_0064"
FT   CDS_pept        complement(73688..74890)
FT                   /locus_tag="Alide_0064"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04233"
FT                   /codon_start="1"
FT                   /product="head morphogenesis protein spp1 gp7"
FT                   /transl_table="11"
FT                   /note="PFAM: head morphogenesis protein SPP1 gp7; KEGG:
FT                   bpt:Bpet4409 F protein (gpF) (protein GP30)"
FT                   /db_xref="GI:319760802"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="GeneID:10102087"
FT                   K"
FT                   /protein_id="YP_004124739.1"
FT   misc_feature    complement(74327..74707)
FT                   /note="Phage Mu protein F like protein; Region: Phage_Mu_F;
FT                   cl10072"
FT                   /db_xref="CDD:142383"
FT                   /locus_tag="Alide_0064"
FT   gene            complement(74883..76379)
FT                   /db_xref="GeneID:10102088"
FT                   /locus_tag="Alide_0065"
FT   CDS_pept        complement(74883..76379)
FT                   /locus_tag="Alide_0065"
FT                   /gene_family="HOG000070347" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06074"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF935; KEGG:
FT                   rsc:RCFBP_11714 hypothetical protein"
FT                   /db_xref="GI:319760803"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="GeneID:10102088"
FT                   /protein_id="YP_004124740.1"
FT   misc_feature    complement(74973..76361)
FT                   /note="Protein of unknown function (DUF935); Region:
FT                   DUF935; pfam06074"
FT                   /db_xref="CDD:147953"
FT                   /locus_tag="Alide_0065"
FT   misc_feature    complement(<75372..>76073)
FT                   /note="Mu-like prophage protein gp29 [Function unknown];
FT                   Region: COG4383"
FT                   /db_xref="CDD:34090"
FT                   /locus_tag="Alide_0065"
FT   gene            complement(76376..77050)
FT                   /db_xref="GeneID:10102089"
FT                   /locus_tag="Alide_0066"
FT   CDS_pept        complement(76376..77050)
FT                   /locus_tag="Alide_0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RC1_1112"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rce:RC1_1112 terminase large subunit"
FT                   /db_xref="GI:319760804"
FT                   /db_xref="GeneID:10102089"
FT                   YE"
FT                   /protein_id="YP_004124741.1"
FT   misc_feature    complement(76409..>76873)
FT                   /note="Mu-like prophage FluMu protein gp28 [General
FT                   function prediction only]; Region: COG4373"
FT                   /db_xref="CDD:34082"
FT                   /locus_tag="Alide_0066"
FT   gene            complement(77062..77247)
FT                   /db_xref="GeneID:10102090"
FT                   /locus_tag="Alide_0067"
FT   CDS_pept        complement(77062..77247)
FT                   /locus_tag="Alide_0067"
FT                   /gene_family="HOG000163567" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BPSL1153"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSL1153 hypothetical protein"
FT                   /db_xref="GI:319760805"
FT                   /db_xref="GeneID:10102090"
FT                   LLMFQRLAALRGSKQS"
FT                   /protein_id="YP_004124742.1"
FT   gene            complement(77251..77721)
FT                   /db_xref="GeneID:10102091"
FT                   /locus_tag="Alide_0068"
FT   CDS_pept        complement(77251..77721)
FT                   /locus_tag="Alide_0068"
FT                   /gene_family="HOG000222052" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CV_2153"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cvi:CV_2153 hypothetical protein"
FT                   /db_xref="GI:319760806"
FT                   /db_xref="GeneID:10102091"
FT                   /protein_id="YP_004124743.1"
FT   gene            77965..78771
FT                   /db_xref="GeneID:10102092"
FT                   /locus_tag="Alide_0069"
FT   CDS_pept        77965..78771
FT                   /locus_tag="Alide_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_4097"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_4097 hypothetical protein"
FT                   /db_xref="GI:319760807"
FT                   /db_xref="GeneID:10102092"
FT                   /protein_id="YP_004124744.1"
FT   gene            78805..79977
FT                   /db_xref="GeneID:10102093"
FT                   /locus_tag="Alide_0070"
FT   CDS_pept        78805..79977
FT                   /locus_tag="Alide_0070"
FT                   /gene_family="HOG000225325" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_2245"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_2245 hypothetical protein"
FT                   /db_xref="GI:319760808"
FT                   /db_xref="GeneID:10102093"
FT                   /protein_id="YP_004124745.1"
FT   gene            79986..80393
FT                   /db_xref="GeneID:10102094"
FT                   /locus_tag="Alide_0071"
FT   CDS_pept        79986..80393
FT                   /locus_tag="Alide_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce2651"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce2651 carbohydrate ABC transporter"
FT                   /db_xref="GI:319760809"
FT                   /db_xref="GeneID:10102094"
FT                   /protein_id="YP_004124746.1"
FT   gene            80393..80824
FT                   /db_xref="GeneID:10102095"
FT                   /locus_tag="Alide_0072"
FT   CDS_pept        80393..80824
FT                   /locus_tag="Alide_0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_4094"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_4094 hypothetical protein"
FT                   /db_xref="GI:319760810"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="GeneID:10102095"
FT                   /protein_id="YP_004124747.1"
FT   gene            80835..82826
FT                   /db_xref="GeneID:10102096"
FT                   /locus_tag="Alide_0073"
FT   CDS_pept        80835..82826
FT                   /locus_tag="Alide_0073"
FT                   /gene_family="HOG000225322" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_4093"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_4093 hypothetical protein"
FT                   /db_xref="GI:319760811"
FT                   /db_xref="GeneID:10102096"
FT                   /protein_id="YP_004124748.1"
FT   gene            82819..83040
FT                   /db_xref="GeneID:10102097"
FT                   /locus_tag="Alide_0074"
FT   CDS_pept        82819..83040
FT                   /locus_tag="Alide_0074"
FT                   /gene_family="HOG000225321" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_2241"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_2241 hypothetical protein"
FT                   /db_xref="GI:319760812"
FT                   /db_xref="GeneID:10102097"
FT                   /protein_id="YP_004124749.1"
FT   gene            83191..83982
FT                   /db_xref="GeneID:10102098"
FT                   /locus_tag="Alide_0075"
FT   CDS_pept        83191..83982
FT                   /locus_tag="Alide_0075"
FT                   /gene_family="HOG000281349" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /codon_start="1"
FT                   /product="d12 class n6 adenine-specific DNA
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: aav:Aave_4108 D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="GI:319760813"
FT                   /db_xref="GO:0009007"
FT                   /db_xref="InterPro:IPR002294"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="GeneID:10102098"
FT                   /protein_id="YP_004124750.1"
FT   misc_feature    83191..83940
FT                   /note="D12 class N6 adenine-specific DNA methyltransferase;
FT                   Region: MethyltransfD12; cl00408"
FT                   /db_xref="CDD:185976"
FT                   /locus_tag="Alide_0075"
FT   gene            complement(84050..84145)
FT                   /db_xref="GeneID:10102099"
FT                   /locus_tag="Alide_0076"
FT                   /pseudo
FT   gene            84303..84878
FT                   /db_xref="GeneID:10102100"
FT                   /locus_tag="Alide_0077"
FT   CDS_pept        84303..84878
FT                   /locus_tag="Alide_0077"
FT                   /gene_family="HOG000291639" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; KEGG:
FT                   dia:Dtpsy_0063 ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase"
FT                   /db_xref="GI:319760814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008817"
FT                   /db_xref="InterPro:IPR002779"
FT                   /db_xref="InterPro:IPR017858"
FT                   /db_xref="GeneID:10102100"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /protein_id="YP_004124751.1"
FT   misc_feature    84369..84803
FT                   /note="Cobalamin adenosyltransferase; Region:
FT                   Cob_adeno_trans; cl00920"
FT                   /db_xref="CDD:186260"
FT                   /locus_tag="Alide_0077"
FT   gene            complement(84939..85361)
FT                   /db_xref="GeneID:10102101"
FT                   /locus_tag="Alide_0078"
FT   CDS_pept        complement(84939..85361)
FT                   /locus_tag="Alide_0078"
FT                   /gene_family="HOG000066991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0044 hypothetical protein"
FT                   /db_xref="GI:319760815"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102101"
FT                   /protein_id="YP_004124752.1"
FT   sig_peptide     complement(85299..85361)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.668) with cleavage site probability 0.597 at
FT                   residue 21"
FT                   /locus_tag="Alide_0078"
FT   misc_feature    complement(84954..85292)
FT                   /note="PaaI_thioesterase is a tetrameric acyl-CoA
FT                   thioesterase with a hot dog fold and one of several
FT                   proteins responsible for phenylacetic acid (PA) degradation
FT                   in bacteria.  Although orthologs of PaaI exist in archaea
FT                   and eukaryotes, their function has not...; Region:
FT                   PaaI_thioesterase; cd03443"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0078"
FT   misc_feature    complement(order(85083..85094,85113..85115,85200..85202))
FT                   /note="CoenzymeA binding site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0078"
FT   misc_feature    complement(order(85092..85094,85098..85112,85182..85184,
FT                   85191..85193,85197..85199))
FT                   /note="subunit interaction site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0078"
FT   misc_feature    complement(order(85113..85115,85155..85160,85167..85172,
FT                   85194..85196))
FT                   /note="PHB binding site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0078"
FT   gene            complement(85444..86910)
FT                   /db_xref="GeneID:10102102"
FT                   /locus_tag="Alide_0079"
FT   CDS_pept        complement(85444..86910)
FT                   /locus_tag="Alide_0079"
FT                   /gene_family="HOG000172597" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03458"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: succinate CoA transferase; KEGG:
FT                   ajs:Ajs_0046 acetyl-CoA hydrolase; PFAM: acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="GI:319760816"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="GeneID:10102102"
FT                   /product="succinate CoA transferase"
FT                   /protein_id="YP_004124753.1"
FT   misc_feature    complement(85456..86910)
FT                   /note="succinate CoA transferases; Region: YgfH_subfam;
FT                   TIGR03458"
FT                   /db_xref="CDD:163273"
FT                   /locus_tag="Alide_0079"
FT   misc_feature    complement(86290..86865)
FT                   /note="Acetyl-CoA hydrolase/transferase N-terminal domain;
FT                   Region: AcetylCoA_hydro; pfam02550"
FT                   /db_xref="CDD:111448"
FT                   /locus_tag="Alide_0079"
FT   gene            87122..87856
FT                   /db_xref="GeneID:10102103"
FT                   /locus_tag="Alide_0080"
FT   CDS_pept        87122..87856
FT                   /locus_tag="Alide_0080"
FT                   /gene_family="HOG000224889" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0067"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0067 hypothetical protein"
FT                   /db_xref="GI:319760817"
FT                   /db_xref="GeneID:10102103"
FT                   /protein_id="YP_004124754.1"
FT   gene            87911..88816
FT                   /db_xref="GeneID:10102104"
FT                   /locus_tag="Alide_0081"
FT   CDS_pept        87911..88816
FT                   /locus_tag="Alide_0081"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rme:Rmet_5369 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760818"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102104"
FT                   /protein_id="YP_004124755.1"
FT   misc_feature    87911..88795
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0081"
FT   misc_feature    87926..88093
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0081"
FT   misc_feature    88184..88765
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0081"
FT   misc_feature    order(88229..88234,88238..88243,88250..88252,88262..88264,
FT                   88268..88288,88562..88579,88595..88600,88604..88609)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Alide_0081"
FT   gene            88941..89951
FT                   /db_xref="GeneID:10102105"
FT                   /locus_tag="Alide_0082"
FT   CDS_pept        88941..89951
FT                   /locus_tag="Alide_0082"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B4598"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4598 hypothetical protein"
FT                   /db_xref="GI:319760819"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102105"
FT                   /protein_id="YP_004124756.1"
FT   sig_peptide     88941..89048
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.975 at
FT                   residue 36"
FT                   /locus_tag="Alide_0082"
FT   misc_feature    89121..89930
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0082"
FT   gene            90000..90806
FT                   /db_xref="GeneID:10102106"
FT                   /locus_tag="Alide_0083"
FT   CDS_pept        90000..90806
FT                   /locus_tag="Alide_0083"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bbr:BB2766 short chain dehydrogenase"
FT                   /db_xref="GI:319760820"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102106"
FT                   /protein_id="YP_004124757.1"
FT   misc_feature    90015..90794
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0083"
FT   misc_feature    90015..90791
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Alide_0083"
FT   gene            90808..91569
FT                   /db_xref="GeneID:10102107"
FT                   /locus_tag="Alide_0084"
FT   CDS_pept        90808..91569
FT                   /locus_tag="Alide_0084"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0736 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760821"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102107"
FT                   /protein_id="YP_004124758.1"
FT   misc_feature    90808..91545
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0084"
FT   misc_feature    90817..91545
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Alide_0084"
FT   gene            91601..92116
FT                   /db_xref="GeneID:10102108"
FT                   /locus_tag="Alide_0085"
FT   CDS_pept        91601..92116
FT                   /locus_tag="Alide_0085"
FT                   /gene_family="HOG000071411" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /codon_start="1"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   pol:Bpro_2144 carboxymuconolactone decarboxylase"
FT                   /db_xref="GI:319760822"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="GeneID:10102108"
FT                   LEAVQIGH"
FT                   /protein_id="YP_004124759.1"
FT   misc_feature    91634..92107
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG2128"
FT                   /db_xref="CDD:32311"
FT                   /locus_tag="Alide_0085"
FT   misc_feature    91715..91951
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:186011"
FT                   /locus_tag="Alide_0085"
FT   gene            complement(92123..93409)
FT                   /db_xref="GeneID:10102109"
FT                   /locus_tag="Alide_0086"
FT   CDS_pept        complement(92123..93409)
FT                   /locus_tag="Alide_0086"
FT                   /gene_family="HOG000038200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /codon_start="1"
FT                   /product="uracil-xanthine permease"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0048 uracil-xanthine permease;
FT                   TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="GI:319760823"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="GeneID:10102109"
FT                   /protein_id="YP_004124760.1"
FT   misc_feature    complement(92132..93361)
FT                   /note="Permease family; Region: Xan_ur_permease; cl00967"
FT                   /db_xref="CDD:186286"
FT                   /locus_tag="Alide_0086"
FT   gene            93561..94271
FT                   /db_xref="GeneID:10102110"
FT                   /locus_tag="Alide_0087"
FT   CDS_pept        93561..94271
FT                   /locus_tag="Alide_0087"
FT                   /gene_family="HOG000042551" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /codon_start="1"
FT                   /product="methyltransferase fkbm family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   sna:Snas_6312 methyltransferase FkbM family"
FT                   /db_xref="GI:319760824"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="GeneID:10102110"
FT                   QEFDCLCVNRNLPR"
FT                   /protein_id="YP_004124761.1"
FT   misc_feature    93687..94109
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Alide_0087"
FT   gene            complement(94398..95666)
FT                   /db_xref="GeneID:10102111"
FT                   /locus_tag="Alide_0088"
FT   CDS_pept        complement(94398..95666)
FT                   /locus_tag="Alide_0088"
FT                   /gene_family="HOG000255771" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /codon_start="1"
FT                   /product="ubiquinone biosynthesis hydroxylase,
FT                   ubih/ubif/visc/coq6 family"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0052 hypothetical protein; TIGRFAM:
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding"
FT                   /db_xref="GI:319760825"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="GeneID:10102111"
FT                   /protein_id="YP_004124762.1"
FT   misc_feature    complement(94440..95648)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Alide_0088"
FT   misc_feature    complement(94422..95636)
FT                   /note="hypothetical protein; Provisional; Region: PRK09126"
FT                   /db_xref="CDD:181663"
FT                   /locus_tag="Alide_0088"
FT   gene            95836..97911
FT                   /db_xref="GeneID:10102112"
FT                   /locus_tag="Alide_0089"
FT   CDS_pept        95836..97911
FT                   /locus_tag="Alide_0089"
FT                   /gene_family="HOG000229992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /codon_start="1"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0074 acetoacetyl-CoA synthetase;
FT                   TIGRFAM: acetoacetyl-CoA synthase; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="GI:319760826"
FT                   /db_xref="GO:0030729"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102112"
FT                   /protein_id="YP_004124763.1"
FT   misc_feature    95845..97878
FT                   /note="acetoacetyl-CoA synthetase; Provisional; Region:
FT                   PRK03584"
FT                   /db_xref="CDD:179600"
FT                   /locus_tag="Alide_0089"
FT   misc_feature    95917..96141
FT                   /note="Domain of unknown function (DUF3448); Region:
FT                   DUF3448; pfam11930"
FT                   /db_xref="CDD:152365"
FT                   /locus_tag="Alide_0089"
FT   misc_feature    96268..97770
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Alide_0089"
FT   gene            complement(97943..98872)
FT                   /db_xref="GeneID:10102113"
FT                   /locus_tag="Alide_0090"
FT   CDS_pept        complement(97943..98872)
FT                   /locus_tag="Alide_0090"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0055 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760827"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102113"
FT                   /protein_id="YP_004124764.1"
FT   misc_feature    complement(98687..98866)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0090"
FT   misc_feature    complement(98000..98575)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators involved in the catabolism of
FT                   aromatic compounds and that of other related regulators,
FT                   contains type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_aromatics_like; cd08414"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Alide_0090"
FT   misc_feature    complement(order(98111..98113,98165..98170,98174..98179,
FT                   98195..98200,98255..98260,98360..98362,98495..98497,
FT                   98501..98503,98507..98509,98531..98533,98540..98545,
FT                   98549..98554,98561..98563))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Alide_0090"
FT   misc_feature    complement(order(98264..98266,98285..98290,98432..98434))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Alide_0090"
FT   gene            98988..99974
FT                   /db_xref="GeneID:10102114"
FT                   /locus_tag="Alide_0091"
FT   CDS_pept        98988..99974
FT                   /locus_tag="Alide_0091"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0056"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0056 hypothetical protein"
FT                   /db_xref="GI:319760828"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102114"
FT                   /protein_id="YP_004124765.1"
FT   sig_peptide     98988..99080
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 31"
FT                   /locus_tag="Alide_0091"
FT   misc_feature    99147..99956
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0091"
FT   gene            100000..101157
FT                   /db_xref="GeneID:10102115"
FT                   /locus_tag="Alide_0092"
FT   CDS_pept        100000..101157
FT                   /locus_tag="Alide_0092"
FT                   /gene_family="HOG000131668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0061 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760829"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102115"
FT                   /protein_id="YP_004124766.1"
FT   misc_feature    100033..101154
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0092"
FT   misc_feature    100039..101148
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0092"
FT   misc_feature    order(100300..100302,100390..100392,100396..100398,
FT                   100489..100491,100495..100497,101095..101103,
FT                   101107..101109,101113..101115)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0092"
FT   gene            101177..102202
FT                   /db_xref="GeneID:10102116"
FT                   /locus_tag="Alide_0093"
FT   CDS_pept        101177..102202
FT                   /locus_tag="Alide_0093"
FT                   /gene_family="HOG000131664" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0062 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760830"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="GeneID:10102116"
FT                   L"
FT                   /protein_id="YP_004124767.1"
FT   misc_feature    <101738..102100
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0093"
FT   gene            102308..103096
FT                   /db_xref="GeneID:10102117"
FT                   /locus_tag="Alide_0094"
FT   CDS_pept        102308..103096
FT                   /locus_tag="Alide_0094"
FT                   /gene_family="HOG000027949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ajs:Ajs_0063 enoyl-CoA hydratase"
FT                   /db_xref="GI:319760831"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102117"
FT                   /protein_id="YP_004124768.1"
FT   misc_feature    102308..103093
FT                   /note="enoyl-CoA hydratase; Provisional; Region: PRK06688"
FT                   /db_xref="CDD:180658"
FT                   /locus_tag="Alide_0094"
FT   misc_feature    102317..102916
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0094"
FT   misc_feature    order(102374..102376,102380..102382,102479..102481,
FT                   102491..102505,102638..102640,102644..102652,
FT                   102716..102721,102728..102730)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0094"
FT   misc_feature    order(102497..102499,102650..102652)
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0094"
FT   misc_feature    order(102590..102592,102614..102616,102677..102688,
FT                   102722..102733,102749..102751,102755..102763,
FT                   102767..102772,102785..102790,102794..102799,
FT                   102803..102808,102815..102817,102848..102850,
FT                   102857..102859,102902..102904,102911..102916)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0094"
FT   gene            103126..103749
FT                   /db_xref="GeneID:10102118"
FT                   /locus_tag="Alide_0095"
FT   CDS_pept        103126..103749
FT                   /locus_tag="Alide_0095"
FT                   /gene_family="HOG000229371" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /codon_start="1"
FT                   /product="cdp-diacylglycerol/serine
FT                   o-phosphatidyltransferase"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; KEGG: dia:Dtpsy_0083
FT                   CDP-diacylglycerol/serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="GI:319760832"
FT                   /db_xref="GO:0003882"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="GeneID:10102118"
FT                   /protein_id="YP_004124769.1"
FT   misc_feature    <103318..103740
FT                   /note="CDP-alcohol phosphatidyltransferase; Region:
FT                   CDP-OH_P_transf; cl00453"
FT                   /db_xref="CDD:186005"
FT                   /locus_tag="Alide_0095"
FT   gene            103858..106059
FT                   /db_xref="GeneID:10102119"
FT                   /locus_tag="Alide_0096"
FT   CDS_pept        103858..106059
FT                   /locus_tag="Alide_0096"
FT                   /gene_family="HOG000262302" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /codon_start="1"
FT                   /product="tonb-dependent siderophore receptor"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: TonB-dependent
FT                   siderophore receptor; KEGG: neu:NE2433 TonB-dependent
FT                   receptor protein; PFAM: TonB-dependent receptor;
FT                   TonB-dependent receptor plug"
FT                   /db_xref="GI:319760833"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0015343"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:10102119"
FT                   /protein_id="YP_004124770.1"
FT   misc_feature    104131..106053
FT                   /note="TonB-dependent siderophore receptor; Region:
FT                   TonB-siderophor; TIGR01783"
FT                   /db_xref="CDD:162535"
FT                   /locus_tag="Alide_0096"
FT   misc_feature    104143..106053
FT                   /note="TonB dependent/Ligand-Gated channels are created by
FT                   a monomeric 22 strand (22,24) anti-parallel beta-barrel.
FT                   Ligands apparently bind to the large extracellular loops.
FT                   The N-terminal 150-200 residues form a plug from the
FT                   periplasmic end of barrel; Region: ligand_gated_channel;
FT                   cd01347"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="Alide_0096"
FT   misc_feature    order(104143..104172,104200..104229,104263..104280,
FT                   104299..104322,104347..104379,104422..104448)
FT                   /note="N-terminal plug; other site"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="Alide_0096"
FT   misc_feature    order(104890..104892,104971..104973)
FT                   /note="ligand-binding site; other site"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="Alide_0096"
FT   gene            106062..107231
FT                   /db_xref="GeneID:10102120"
FT                   /locus_tag="Alide_0097"
FT   CDS_pept        106062..107231
FT                   /locus_tag="Alide_0097"
FT                   /gene_family="HOG000225368" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:NE2432"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: neu:NE2432 hypothetical protein"
FT                   /db_xref="GI:319760834"
FT                   /db_xref="GeneID:10102120"
FT                   /protein_id="YP_004124771.1"
FT   misc_feature    106071..107135
FT                   /note="Uncharacterized iron-regulated membrane protein
FT                   [Function unknown]; Region: PiuB; COG3182"
FT                   /db_xref="CDD:32995"
FT                   /locus_tag="Alide_0097"
FT   gene            107228..107437
FT                   /db_xref="GeneID:10102121"
FT                   /locus_tag="Alide_0098"
FT   CDS_pept        107228..107437
FT                   /locus_tag="Alide_0098"
FT                   /gene_family="HOG000289419" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rpal_2080"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpt:Rpal_2080 hypothetical protein"
FT                   /db_xref="GI:319760835"
FT                   /db_xref="GeneID:10102121"
FT                   /protein_id="YP_004124772.1"
FT   gene            107604..108365
FT                   /db_xref="GeneID:10102122"
FT                   /locus_tag="Alide_0099"
FT   CDS_pept        107604..108365
FT                   /locus_tag="Alide_0099"
FT                   /gene_family="HOG000062060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /codon_start="1"
FT                   /product="septum site-determining protein minc"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0084 septum site-determining protein
FT                   MinC; TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC"
FT                   /db_xref="GI:319760836"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="GeneID:10102122"
FT                   /protein_id="YP_004124773.1"
FT   misc_feature    107634..108362
FT                   /note="septum formation inhibitor; Reviewed; Region:
FT                   PRK01973"
FT                   /db_xref="CDD:179357"
FT                   /locus_tag="Alide_0099"
FT   misc_feature    107643..107876
FT                   /note="Septum formation inhibitor MinC, N-terminal domain;
FT                   Region: MinC_N; pfam05209"
FT                   /db_xref="CDD:113960"
FT                   /locus_tag="Alide_0099"
FT   misc_feature    108045..108362
FT                   /note="Septum formation inhibitor MinC, C-terminal domain;
FT                   Region: MinC_C; pfam03775"
FT                   /db_xref="CDD:146423"
FT                   /locus_tag="Alide_0099"
FT   gene            108420..109235
FT                   /db_xref="GeneID:10102123"
FT                   /locus_tag="Alide_0100"
FT   CDS_pept        108420..109235
FT                   /locus_tag="Alide_0100"
FT                   /gene_family="HOG000019419" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /codon_start="1"
FT                   /product="septum site-determining protein mind"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: septum site-determining protein MinD; KEGG:
FT                   dia:Dtpsy_0085 septum site-determining protein MinD"
FT                   /db_xref="GI:319760837"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="GeneID:10102123"
FT                   /protein_id="YP_004124774.1"
FT   misc_feature    108513..109136
FT                   /note="Bacterial cell division requires the formation of a
FT                   septum at mid-cell. The site is determined by the min
FT                   operon products MinC, MinD and MinE. MinC is a nonspecific
FT                   inhibitor of the septum protein FtsZ. MinE is the supressor
FT                   of MinC. MinD plays a...; Region: MinD; cd02036"
FT                   /db_xref="CDD:73299"
FT                   /locus_tag="Alide_0100"
FT   misc_feature    108531..108539
FT                   /note="Switch I; other site"
FT                   /db_xref="CDD:73299"
FT                   /locus_tag="Alide_0100"
FT   misc_feature    108777..108791
FT                   /note="Switch II; other site"
FT                   /db_xref="CDD:73299"
FT                   /locus_tag="Alide_0100"
FT   gene            109242..109511
FT                   /db_xref="GeneID:10102124"
FT                   /locus_tag="Alide_0101"
FT   CDS_pept        109242..109511
FT                   /locus_tag="Alide_0101"
FT                   /gene_family="HOG000218362" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01215"
FT                   /codon_start="1"
FT                   /product="cell division topological specificity factor
FT                   mine"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0086 cell division topological
FT                   specificity factor MinE; TIGRFAM: cell division topological
FT                   specificity factor MinE; PFAM: Septum formation topological
FT                   specificity factor MinE"
FT                   /db_xref="GI:319760838"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="GeneID:10102124"
FT                   /protein_id="YP_004124775.1"
FT   misc_feature    109242..109496
FT                   /note="Septum formation topological specificity factor
FT                   MinE; Region: MinE; cl00538"
FT                   /db_xref="CDD:186067"
FT                   /locus_tag="Alide_0101"
FT   gene            complement(109535..110473)
FT                   /db_xref="GeneID:10102125"
FT                   /locus_tag="Alide_0102"
FT   CDS_pept        complement(109535..110473)
FT                   /locus_tag="Alide_0102"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pna:Pnap_1015 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760839"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102125"
FT                   /protein_id="YP_004124776.1"
FT   misc_feature    complement(109565..110449)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0102"
FT   misc_feature    complement(110273..110443)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0102"
FT   misc_feature    complement(109595..110188)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator
FT                   CrgA-like, contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_CrgA_like_9; cd08479"
FT                   /db_xref="CDD:176168"
FT                   /locus_tag="Alide_0102"
FT   misc_feature    complement(order(109658..109660,109739..109741,
FT                   109790..109792,109979..109981,109985..109987,
FT                   110027..110029,110144..110146,110156..110158))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176168"
FT                   /locus_tag="Alide_0102"
FT   misc_feature    complement(order(109763..109765,109772..109777,
FT                   109796..109810,109898..109900,110081..110101,
FT                   110105..110107,110117..110119,110126..110131,
FT                   110135..110140,110150..110155))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176168"
FT                   /locus_tag="Alide_0102"
FT   gene            110587..111564
FT                   /db_xref="GeneID:10102126"
FT                   /locus_tag="Alide_0103"
FT   CDS_pept        110587..111564
FT                   /locus_tag="Alide_0103"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bpro_4513"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_4513 hypothetical protein"
FT                   /db_xref="GI:319760840"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102126"
FT                   /protein_id="YP_004124777.1"
FT   sig_peptide     110587..110673
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.963 at
FT                   residue 29"
FT                   /locus_tag="Alide_0103"
FT   misc_feature    110731..111552
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0103"
FT   gene            111592..112755
FT                   /db_xref="GeneID:10102127"
FT                   /locus_tag="Alide_0104"
FT   CDS_pept        111592..112755
FT                   /locus_tag="Alide_0104"
FT                   /gene_family="HOG000113756" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /codon_start="1"
FT                   /product="mandelate racemase/muconate lactonizing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: mes:Meso_4537 galactonate dehydratase"
FT                   /db_xref="GI:319760841"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="GeneID:10102127"
FT                   /protein_id="YP_004124778.1"
FT   misc_feature    111592..112659
FT                   /note="galactonate dehydratase; Provisional; Region:
FT                   PRK14017"
FT                   /db_xref="CDD:184455"
FT                   /locus_tag="Alide_0104"
FT   misc_feature    111613..112662
FT                   /note="Mandelate racemase (MR)-like subfamily of the
FT                   enolase superfamily. Enzymes of this subgroup share three
FT                   conserved carboxylate ligands for the essential divalent
FT                   metal ion (usually Mg2+), two aspartates and a glutamate,
FT                   and conserved catalytic residues...; Region: MR_like;
FT                   cd03316"
FT                   /db_xref="CDD:48191"
FT                   /locus_tag="Alide_0104"
FT   misc_feature    order(112015..112017,112021..112023,112150..112152,
FT                   112228..112230,112306..112308,112375..112377,
FT                   112456..112458,112531..112533)
FT                   /note="active site pocket"
FT                   /db_xref="CDD:48191"
FT                   /locus_tag="Alide_0104"
FT   gene            complement(112786..113325)
FT                   /db_xref="GeneID:10102128"
FT                   /locus_tag="Alide_0105"
FT   CDS_pept        complement(112786..113325)
FT                   /locus_tag="Alide_0105"
FT                   /gene_family="HOG000115783" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /codon_start="1"
FT                   /product="flavin reductase domain protein fmn-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0068 flavin reductase
FT                   domain-containing protein; manually curated; PFAM: flavin
FT                   reductase domain protein FMN-binding"
FT                   /db_xref="GI:319760842"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="GeneID:10102128"
FT                   YTEHALGQLADTVIGP"
FT                   /protein_id="YP_004124779.1"
FT   misc_feature    complement(112831..113265)
FT                   /note="Flavin Reductases; Region: FlaRed; cl00801"
FT                   /db_xref="CDD:186194"
FT                   /locus_tag="Alide_0105"
FT   gene            113432..114208
FT                   /db_xref="GeneID:10102129"
FT                   /locus_tag="Alide_0106"
FT   CDS_pept        113432..114208
FT                   /locus_tag="Alide_0106"
FT                   /gene_family="HOG000028072" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   dia:Dtpsy_0088 alpha/beta hydrolase fold protein"
FT                   /db_xref="GI:319760843"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="GeneID:10102129"
FT                   /protein_id="YP_004124780.1"
FT   misc_feature    113474..114184
FT                   /note="pyrimidine utilization protein D; Region: RutD;
FT                   TIGR03611"
FT                   /db_xref="CDD:163354"
FT                   /locus_tag="Alide_0106"
FT   misc_feature    113552..114178
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Alide_0106"
FT   gene            114282..114947
FT                   /db_xref="GeneID:10102130"
FT                   /locus_tag="Alide_0107"
FT   CDS_pept        114282..114947
FT                   /locus_tag="Alide_0107"
FT                   /gene_family="HOG000224898" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="regulatory protein tetr"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ajs:Ajs_0073
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:319760844"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:10102130"
FT                   /protein_id="YP_004124781.1"
FT   misc_feature    114357..114497
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Alide_0107"
FT   gene            complement(114895..115317)
FT                   /db_xref="GeneID:10102131"
FT                   /locus_tag="Alide_0108"
FT   CDS_pept        complement(114895..115317)
FT                   /locus_tag="Alide_0108"
FT                   /gene_family="HOG000238897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /codon_start="1"
FT                   /product="uspa domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UspA domain-containing protein; KEGG:
FT                   ajs:Ajs_0074 UspA domain-containing protein"
FT                   /db_xref="GI:319760845"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="GeneID:10102131"
FT                   /protein_id="YP_004124782.1"
FT   misc_feature    complement(114901..115314)
FT                   /note="Usp: Universal stress protein family. The universal
FT                   stress protein Usp is a small cytoplasmic bacterial protein
FT                   whose expression is enhanced when the cell is exposed to
FT                   stress agents. Usp enhances the rate of cell survival
FT                   during prolonged exposure to...; Region: USP_Like; cd00293"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Alide_0108"
FT   misc_feature    complement(order(114943..114954,114982..114987,
FT                   114991..114996,115204..115206,115294..115302))
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Alide_0108"
FT   gene            complement(115419..116264)
FT                   /db_xref="GeneID:10102132"
FT                   /locus_tag="Alide_0109"
FT   CDS_pept        complement(115419..116264)
FT                   /locus_tag="Alide_0109"
FT                   /gene_family="HOG000259395" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ajs:Ajs_0075
FT                   metallophosphoesterase"
FT                   /db_xref="GI:319760846"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:10102132"
FT                   "
FT                   /protein_id="YP_004124783.1"
FT   misc_feature    complement(115473..116258)
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:187208"
FT                   /locus_tag="Alide_0109"
FT   misc_feature    complement(order(115563..115565,115680..115682,
FT                   116046..116051,116166..116168,116235..116237,
FT                   116241..116243))
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Alide_0109"
FT   misc_feature    complement(order(115563..115565,115680..115682,
FT                   116049..116051,116166..116168,116235..116237,
FT                   116241..116243))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Alide_0109"
FT   gene            complement(116291..117262)
FT                   /db_xref="GeneID:10102133"
FT                   /locus_tag="Alide_0110"
FT   CDS_pept        complement(116291..117262)
FT                   /locus_tag="Alide_0110"
FT                   /gene_family="HOG000103695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0076 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760847"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102133"
FT                   /protein_id="YP_004124784.1"
FT   misc_feature    complement(116345..117244)
FT                   /note="leucine transcriptional activator; Reviewed; Region:
FT                   leuO; PRK09508"
FT                   /db_xref="CDD:181918"
FT                   /locus_tag="Alide_0110"
FT   misc_feature    complement(117056..117232)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0110"
FT   misc_feature    complement(116330..116965)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators that involved in the catabolism
FT                   of nitroaromatic/naphthalene compounds and that of related
FT                   regulators; contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_Nitroaromatics_like; cd08417"
FT                   /db_xref="CDD:176109"
FT                   /locus_tag="Alide_0110"
FT   misc_feature    complement(order(116402..116404,116603..116605,
FT                   116714..116716,116924..116926,116936..116941,
FT                   116945..116947))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176109"
FT                   /locus_tag="Alide_0110"
FT   misc_feature    complement(order(116507..116509,116516..116521,
FT                   116528..116533,116540..116554,116636..116638,
FT                   116861..116863,116867..116881,116885..116890,
FT                   116897..116902,116906..116911,116918..116923,
FT                   116930..116935,116942..116944))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176109"
FT                   /locus_tag="Alide_0110"
FT   gene            117388..117828
FT                   /db_xref="GeneID:10102134"
FT                   /locus_tag="Alide_0111"
FT   CDS_pept        117388..117828
FT                   /locus_tag="Alide_0111"
FT                   /gene_family="HOG000224899" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0077"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0077 hypothetical protein"
FT                   /db_xref="GI:319760848"
FT                   /db_xref="GeneID:10102134"
FT                   /protein_id="YP_004124785.1"
FT   gene            complement(117968..119836)
FT                   /db_xref="GeneID:10102135"
FT                   /locus_tag="Alide_0112"
FT   CDS_pept        complement(117968..119836)
FT                   /locus_tag="Alide_0112"
FT                   /gene_family="HOG000191700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0114 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="GI:319760849"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="GeneID:10102135"
FT                   /product="phosphoenolpyruvate carboxykinase (gtp)"
FT                   /protein_id="YP_004124786.1"
FT   misc_feature    complement(117989..119773)
FT                   /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
FT                   critical gluconeogenic enzyme, catalyzes the first
FT                   committed step in the diversion of tricarboxylic acid cycle
FT                   intermediates toward gluconeogenesis. It catalyzes the
FT                   reversible decarboxylation and...; Region: PEPCK_GTP;
FT                   cd00819"
FT                   /db_xref="CDD:29831"
FT                   /locus_tag="Alide_0112"
FT   misc_feature    complement(117971..119767)
FT                   /note="Phosphoenolpyruvate carboxykinase; Region: PEPCK;
FT                   pfam00821"
FT                   /db_xref="CDD:144423"
FT                   /locus_tag="Alide_0112"
FT   misc_feature    complement(order(118238..118240,118247..118249,
FT                   118256..118258,118631..118633,118829..118831,
FT                   118856..118858,118862..118864,118928..118933,
FT                   118991..119011,119075..119077,119135..119140,
FT                   119156..119158,119162..119164,119585..119587))
FT                   /note="active site"
FT                   /db_xref="CDD:29831"
FT                   /locus_tag="Alide_0112"
FT   misc_feature    complement(order(118631..118633,118862..118864,
FT                   119135..119140,119156..119158,119162..119164,
FT                   119585..119587))
FT                   /note="substrate-binding site; other site"
FT                   /db_xref="CDD:29831"
FT                   /locus_tag="Alide_0112"
FT   misc_feature    complement(order(118862..118864,118928..118933,
FT                   118994..118996,119075..119077,119135..119137))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29831"
FT                   /locus_tag="Alide_0112"
FT   misc_feature    complement(order(118238..118240,118247..118249,
FT                   118256..118258,118286..118291,118538..118540,
FT                   119000..119002,119006..119008))
FT                   /note="GTP binding site; other site"
FT                   /db_xref="CDD:29831"
FT                   /locus_tag="Alide_0112"
FT   gene            complement(120176..120337)
FT                   /db_xref="GeneID:10102136"
FT                   /locus_tag="Alide_0113"
FT   CDS_pept        complement(120176..120337)
FT                   /locus_tag="Alide_0113"
FT                   /gene_family="HOG000229491" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0098"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0098 hypothetical protein"
FT                   /db_xref="GI:319760850"
FT                   /db_xref="GeneID:10102136"
FT                   ALIAVTMA"
FT                   /protein_id="YP_004124787.1"
FT   gene            complement(120427..121626)
FT                   /db_xref="GeneID:10102137"
FT                   /locus_tag="Alide_0114"
FT   CDS_pept        complement(120427..121626)
FT                   /locus_tag="Alide_0114"
FT                   /gene_family="HOG000046972" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /codon_start="1"
FT                   /product="threonine dehydratase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0099 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="GI:319760851"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="GeneID:10102137"
FT                   "
FT                   /protein_id="YP_004124788.1"
FT   misc_feature    complement(120430..121626)
FT                   /note="threonine dehydratase; Provisional; Region:
FT                   PRK07334"
FT                   /db_xref="CDD:180936"
FT                   /locus_tag="Alide_0114"
FT   misc_feature    complement(120712..121617)
FT                   /note="Threonine dehydratase: The first step in amino acid
FT                   degradation is the removal of nitrogen. Although the
FT                   nitrogen atoms of most amino acids are transferred to
FT                   alpha-ketoglutarate before removal, the alpha-amino group
FT                   of threonine can be directly...; Region: Thr-dehyd;
FT                   cd01562"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="Alide_0114"
FT   misc_feature    complement(order(120712..120723,120814..120822,
FT                   120832..120834,120841..120846,120853..120855,
FT                   121054..121059,121495..121500,121591..121596,
FT                   121603..121605,121612..121617))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="Alide_0114"
FT   misc_feature    complement(order(120727..120729,121084..121098,
FT                   121393..121395,121474..121476))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="Alide_0114"
FT   misc_feature    complement(121474..121476)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="Alide_0114"
FT   misc_feature    complement(120448..120651)
FT                   /note="C-terminal ACT domain of biodegradative (catabolic)
FT                   threonine dehydratase II (ThrD-II) and other related ACT
FT                   domains; Region: ACT_ThrD-II-like; cd04886"
FT                   /db_xref="CDD:153158"
FT                   /locus_tag="Alide_0114"
FT   gene            complement(121729..123390)
FT                   /db_xref="GeneID:10102138"
FT                   /locus_tag="Alide_0115"
FT   CDS_pept        complement(121729..123390)
FT                   /locus_tag="Alide_0115"
FT                   /gene_family="HOG000253935" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0081 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760852"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="GeneID:10102138"
FT                   /protein_id="YP_004124789.1"
FT   misc_feature    complement(121741..123390)
FT                   /note="isovaleryl CoA dehydrogenase; Provisional; Region:
FT                   PRK11561"
FT                   /db_xref="CDD:183199"
FT                   /locus_tag="Alide_0115"
FT   misc_feature    complement(122050..123324)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0115"
FT   misc_feature    complement(order(122086..122088,122092..122094,
FT                   122098..122106,122731..122733,122737..122739,
FT                   122845..122847,122851..122853,122974..122976))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0115"
FT   gene            complement(123446..126166)
FT                   /db_xref="GeneID:10102139"
FT                   /locus_tag="Alide_0116"
FT   CDS_pept        complement(123446..126166)
FT                   /locus_tag="Alide_0116"
FT                   /gene_family="HOG000265624" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /codon_start="1"
FT                   /product="magnesium-translocating p-type atpase"
FT                   /transl_table="11"
FT                   /note="KEGG: pfl:PFL_4078 magnesium-transporting ATPase
FT                   MgtA; TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:319760853"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015444"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:10102139"
FT                   /protein_id="YP_004124790.1"
FT   misc_feature    complement(123449..126166)
FT                   /note="magnesium-transporting ATPase MgtA; Provisional;
FT                   Region: PRK10517"
FT                   /db_xref="CDD:182511"
FT                   /locus_tag="Alide_0116"
FT   misc_feature    complement(125846..>125971)
FT                   /note="Cation transporter/ATPase, N-terminus; Region:
FT                   Cation_ATPase_N; cl02930"
FT                   /db_xref="CDD:155184"
FT                   /locus_tag="Alide_0116"
FT   misc_feature    complement(125057..125779)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Alide_0116"
FT   misc_feature    complement(124079..>124369)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:187016"
FT                   /locus_tag="Alide_0116"
FT   misc_feature    complement(123479..123979)
FT                   /note="Cation transporting ATPase, C-terminus; Region:
FT                   Cation_ATPase_C; pfam00689"
FT                   /db_xref="CDD:144331"
FT                   /locus_tag="Alide_0116"
FT   gene            complement(126301..127332)
FT                   /db_xref="GeneID:10102140"
FT                   /locus_tag="Alide_0117"
FT   CDS_pept        complement(126301..127332)
FT                   /locus_tag="Alide_0117"
FT                   /gene_family="HOG000265279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /codon_start="1"
FT                   /product="homocysteine s-methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ajs:Ajs_0083 methionine synthase (B12-dependent)"
FT                   /db_xref="GI:319760854"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="GeneID:10102140"
FT                   AVS"
FT                   /protein_id="YP_004124791.1"
FT   misc_feature    complement(126340..127317)
FT                   /note="Methionine synthase I (cobalamin-dependent),
FT                   methyltransferase domain [Amino acid transport and
FT                   metabolism]; Region: MetH; COG0646"
FT                   /db_xref="CDD:30991"
FT                   /locus_tag="Alide_0117"
FT   misc_feature    complement(126343..127284)
FT                   /note="Homocysteine/selenocysteine methylase
FT                   (S-methylmethionine-dependent) [Amino acid transport and
FT                   metabolism]; Region: MHT1; cl14105"
FT                   /db_xref="CDD:187229"
FT                   /locus_tag="Alide_0117"
FT   gene            complement(127329..128330)
FT                   /db_xref="GeneID:10102141"
FT                   /locus_tag="Alide_0118"
FT   CDS_pept        complement(127329..128330)
FT                   /locus_tag="Alide_0118"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: aav:Aave_0175 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760855"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102141"
FT                   /protein_id="YP_004124792.1"
FT   misc_feature    complement(127362..128213)
FT                   /note="DNA-binding transcriptional activator XapR;
FT                   Provisional; Region: PRK09986"
FT                   /db_xref="CDD:182183"
FT                   /locus_tag="Alide_0118"
FT   misc_feature    complement(128034..128213)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0118"
FT   misc_feature    complement(127362..127946)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator similar
FT                   to regulators involved in the catabolism of aromatic
FT                   compounds, contains type 2 periplasmic binding fold;
FT                   Region: PBP2_LTTR_aromatics_like_2; cd08448"
FT                   /db_xref="CDD:176139"
FT                   /locus_tag="Alide_0118"
FT   misc_feature    complement(order(127461..127463,127515..127520,
FT                   127524..127529,127545..127550,127605..127610,
FT                   127710..127712,127842..127844,127848..127850,
FT                   127854..127856,127878..127880,127887..127892,
FT                   127896..127901,127908..127910,127929..127931))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176139"
FT                   /locus_tag="Alide_0118"
FT   misc_feature    complement(order(127614..127616,127635..127640,
FT                   127779..127781,127926..127928))
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:176139"
FT                   /locus_tag="Alide_0118"
FT   gene            complement(128355..129518)
FT                   /db_xref="GeneID:10102142"
FT                   /locus_tag="Alide_0119"
FT   CDS_pept        complement(128355..129518)
FT                   /locus_tag="Alide_0119"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: aav:Aave_0176 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760856"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102142"
FT                   /protein_id="YP_004124793.1"
FT   misc_feature    complement(128358..129518)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0119"
FT   misc_feature    complement(128436..129500)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0119"
FT   misc_feature    complement(order(129042..129044,129048..129050,
FT                   129141..129143,129147..129149,129237..129239))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0119"
FT   gene            complement(129515..129898)
FT                   /db_xref="GeneID:10102143"
FT                   /locus_tag="Alide_0120"
FT   CDS_pept        complement(129515..129898)
FT                   /locus_tag="Alide_0120"
FT                   /gene_family="HOG000224904" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   aav:Aave_0177 cupin 2 domain-containing protein"
FT                   /db_xref="GI:319760857"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:10102143"
FT                   /protein_id="YP_004124794.1"
FT   misc_feature    complement(129560..129763)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Alide_0120"
FT   gene            complement(129915..130880)
FT                   /db_xref="GeneID:10102144"
FT                   /locus_tag="Alide_0121"
FT   CDS_pept        complement(129915..130880)
FT                   /locus_tag="Alide_0121"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_0180"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0180 hypothetical protein"
FT                   /db_xref="GI:319760858"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102144"
FT                   /protein_id="YP_004124795.1"
FT   sig_peptide     complement(130809..130880)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.740 at
FT                   residue 24"
FT                   /locus_tag="Alide_0121"
FT   misc_feature    complement(129927..130745)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0121"
FT   gene            131138..133006
FT                   /db_xref="GeneID:10102145"
FT                   /locus_tag="Alide_0122"
FT   CDS_pept        131138..133006
FT                   /locus_tag="Alide_0122"
FT                   /gene_family="HOG000044388" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /codon_start="1"
FT                   /product="ATP-dependent DNA helicase recq"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecQ;
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: RQC domain;
FT                   helicase domain protein; DEAD/DEAH box helicase domain
FT                   protein; HRDC domain protein; KEGG: dia:Dtpsy_0103
FT                   ATP-dependent DNA helicase RecQ; SMART: helicase domain
FT                   protein; DEAD-like helicase ; HRDC domain protein"
FT                   /db_xref="GI:319760859"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018329"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="GeneID:10102145"
FT                   /protein_id="YP_004124796.1"
FT   misc_feature    131156..133000
FT                   /note="ATP-dependent DNA helicase RecQ; Region: recQ;
FT                   TIGR01389"
FT                   /db_xref="CDD:130456"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    131234..131647
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    131258..131272
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    131570..131581
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    131768..132151
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    order(131867..131878,131936..131941,132014..132022)
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    order(132038..132040,132101..132103,132113..132115,
FT                   132122..132124)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    132368..132673
FT                   /note="RQC domain; Region: RQC; pfam09382"
FT                   /db_xref="CDD:150151"
FT                   /locus_tag="Alide_0122"
FT   misc_feature    132815..132997
FT                   /note="HRDC domain; Region: HRDC; cl02578"
FT                   /db_xref="CDD:154997"
FT                   /locus_tag="Alide_0122"
FT   gene            complement(133010..133690)
FT                   /db_xref="GeneID:10102146"
FT                   /locus_tag="Alide_0123"
FT   CDS_pept        complement(133010..133690)
FT                   /locus_tag="Alide_0123"
FT                   /gene_family="HOG000228031" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /codon_start="1"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0085 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   TIGRFAM: anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="GI:319760860"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="GeneID:10102146"
FT                   LRRA"
FT                   /protein_id="YP_004124797.1"
FT   misc_feature    complement(<133187..133603)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Alide_0123"
FT   misc_feature    complement(order(133187..133189,133313..133315,
FT                   133367..133375,133445..133450,133454..133456,
FT                   133559..133567,133571..133573,133577..133579,
FT                   133583..133585))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Alide_0123"
FT   gene            complement(133668..133868)
FT                   /db_xref="GeneID:10102147"
FT                   /locus_tag="Alide_0124"
FT   CDS_pept        complement(133668..133868)
FT                   /locus_tag="Alide_0124"
FT                   /gene_family="HOG000100312" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0105"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0105 hypothetical protein"
FT                   /db_xref="GI:319760861"
FT                   /db_xref="GeneID:10102147"
FT                   /protein_id="YP_004124798.1"
FT   misc_feature    complement(133713..>133796)
FT                   /note="anaerobic ribonucleoside-triphosphate reductase;
FT                   Region: NrdD; TIGR02487"
FT                   /db_xref="CDD:162883"
FT                   /locus_tag="Alide_0124"
FT   gene            complement(133951..135981)
FT                   /db_xref="GeneID:10102148"
FT                   /locus_tag="Alide_0125"
FT   CDS_pept        complement(133951..135981)
FT                   /locus_tag="Alide_0125"
FT                   /gene_family="HOG000100301" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /codon_start="1"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0106 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: ATP-cone
FT                   domain protein"
FT                   /db_xref="GI:319760862"
FT                   /db_xref="GO:0008998"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="GeneID:10102148"
FT                   /protein_id="YP_004124799.1"
FT   misc_feature    complement(133996..135951)
FT                   /note="anaerobic ribonucleoside triphosphate reductase;
FT                   Provisional; Region: PRK08270"
FT                   /db_xref="CDD:181341"
FT                   /locus_tag="Alide_0125"
FT   misc_feature    complement(135679..135939)
FT                   /note="ATP cone domain; Region: ATP-cone; pfam03477"
FT                   /db_xref="CDD:146230"
FT                   /locus_tag="Alide_0125"
FT   misc_feature    complement(133996..135591)
FT                   /note="Class III ribonucleotide reductase; Region: RNR_III;
FT                   cd01675"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="Alide_0125"
FT   misc_feature    complement(order(134335..134337,134344..134355,
FT                   135220..135222,135316..135318,135325..135330,
FT                   135337..135339,135349..135357,135364..135369,
FT                   135451..135456,135460..135462))
FT                   /note="effector binding site; other site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="Alide_0125"
FT   misc_feature    complement(order(134350..134352,134359..134361,
FT                   134728..134730,134809..134814,135139..135141,
FT                   135280..135282,135427..135429))
FT                   /note="active site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="Alide_0125"
FT   misc_feature    complement(order(133999..134001,134008..134010,
FT                   134038..134040,134047..134049))
FT                   /note="Zn binding site; other site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="Alide_0125"
FT   gene            complement(136106..139408)
FT                   /db_xref="GeneID:10102149"
FT                   /locus_tag="Alide_0126"
FT   CDS_pept        complement(136106..139408)
FT                   /locus_tag="Alide_0126"
FT                   /gene_family="HOG000224109" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   ajs:Ajs_0088 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAC repeat-containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="GI:319760863"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:10102149"
FT                   /protein_id="YP_004124800.1"
FT   misc_feature    complement(138233..138559)
FT                   /note="PAS fold; Region: PAS_4; pfam08448"
FT                   /db_xref="CDD:117025"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(137408..137770)
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(137438..137734)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(order(137525..137527,137540..137542,
FT                   137618..137629,137666..137668,137684..137686,
FT                   137696..137698))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(order(137498..137500,137504..137506,
FT                   137588..137593,137600..137602,137624..137626,
FT                   137636..137638))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(136922..137395)
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(order(137153..137155,137282..137284))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(order(137150..137161,137165..137167,
FT                   137231..137233,137243..137245,137255..137260,
FT                   137267..137269))
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(order(137093..137095,137177..137179))
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Alide_0126"
FT   misc_feature    complement(136148..136864)
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Alide_0126"
FT   gene            complement(139694..140122)
FT                   /db_xref="GeneID:10102150"
FT                   /locus_tag="Alide_0127"
FT   CDS_pept        complement(139694..140122)
FT                   /locus_tag="Alide_0127"
FT                   /gene_family="HOG000229492" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /codon_start="1"
FT                   /product="hemerythrin hhe cation binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: dia:Dtpsy_0108 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="GI:319760864"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="GeneID:10102150"
FT                   /protein_id="YP_004124801.1"
FT   gene            complement(140192..142501)
FT                   /db_xref="GeneID:10102151"
FT                   /locus_tag="Alide_0128"
FT   CDS_pept        complement(140192..142501)
FT                   /locus_tag="Alide_0128"
FT                   /gene_family="HOG000288072" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0109"
FT                   /codon_start="1"
FT                   /product="nitric oxide reductase large subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0109 nitric oxide reductase large
FT                   subunit"
FT                   /db_xref="GI:319760865"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="GeneID:10102151"
FT                   RTPAAPSTGALAGASR"
FT                   /protein_id="YP_004124802.1"
FT   misc_feature    complement(140255..142492)
FT                   /note="Heme-copper oxidase subunit I.  Heme-copper oxidases
FT                   are transmembrane protein complexes in the respiratory
FT                   chains of prokaryotes and mitochondria which catalyze the
FT                   reduction of O2 and simultaneously pump protons across the
FT                   membrane.  The superfamily...; Region: Heme_Cu_Oxidase_I;
FT                   cl00275"
FT                   /db_xref="CDD:185877"
FT                   /locus_tag="Alide_0128"
FT   gene            142653..144266
FT                   /db_xref="GeneID:10102152"
FT                   /locus_tag="Alide_0129"
FT   CDS_pept        142653..144266
FT                   /locus_tag="Alide_0129"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0110 anaerobic nitric oxide
FT                   reductase transcription regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="GI:319760866"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:10102152"
FT                   /protein_id="YP_004124803.1"
FT   misc_feature    142674..144263
FT                   /note="anaerobic nitric oxide reductase transcription
FT                   regulator; Provisional; Region: PRK05022"
FT                   /db_xref="CDD:179916"
FT                   /locus_tag="Alide_0129"
FT   misc_feature    143325..143744
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0129"
FT   misc_feature    143340..143363
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0129"
FT   misc_feature    order(143343..143366,143553..143555,143679..143681)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0129"
FT   misc_feature    143541..143558
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0129"
FT   misc_feature    143736..143738
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0129"
FT   gene            complement(144319..144981)
FT                   /db_xref="GeneID:10102153"
FT                   /locus_tag="Alide_0130"
FT   CDS_pept        complement(144319..144981)
FT                   /locus_tag="Alide_0130"
FT                   /gene_family="HOG000079537" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_2843"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_2843 hypothetical protein"
FT                   /db_xref="GI:319760867"
FT                   /db_xref="InterPro:IPR014602"
FT                   /db_xref="GeneID:10102153"
FT                   /protein_id="YP_004124804.1"
FT   misc_feature    complement(144391..144918)
FT                   /note="nitrobindin heme-binding domain; Region:
FT                   nitrobindin; cd07828"
FT                   /db_xref="CDD:143652"
FT                   /locus_tag="Alide_0130"
FT   misc_feature    complement(order(144409..144414,144448..144450,
FT                   144454..144456,144460..144462,144520..144522,
FT                   144526..144528,144649..144651,144712..144717,
FT                   144742..144744,144826..144828,144832..144834,
FT                   144841..144846))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:143652"
FT                   /locus_tag="Alide_0130"
FT   gene            145218..146606
FT                   /db_xref="GeneID:10102154"
FT                   /locus_tag="Alide_0131"
FT   CDS_pept        145218..146606
FT                   /locus_tag="Alide_0131"
FT                   /gene_family="HOG000036732" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG:
FT                   dia:Dtpsy_0112 L-serine dehydratase 1; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain"
FT                   /db_xref="GI:319760868"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="GeneID:10102154"
FT                   IVEC"
FT                   /product="l-serine dehydratase 1"
FT                   /protein_id="YP_004124805.1"
FT   misc_feature    145224..146597
FT                   /note="L-serine dehydratase, iron-sulfur-dependent, single
FT                   chain form; Region: sda_mono; TIGR00720"
FT                   /db_xref="CDD:129803"
FT                   /locus_tag="Alide_0131"
FT   misc_feature    145248..145694
FT                   /note="Serine dehydratase beta chain; Region: SDH_beta;
FT                   pfam03315"
FT                   /db_xref="CDD:146115"
FT                   /locus_tag="Alide_0131"
FT   misc_feature    145851..146591
FT                   /note="Serine dehydratase alpha chain; Region: SDH_alpha;
FT                   cl12120"
FT                   /db_xref="CDD:159780"
FT                   /locus_tag="Alide_0131"
FT   gene            146738..147688
FT                   /db_xref="GeneID:10102155"
FT                   /locus_tag="Alide_0132"
FT   CDS_pept        146738..147688
FT                   /locus_tag="Alide_0132"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0114"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0114 hypothetical protein"
FT                   /db_xref="GI:319760869"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102155"
FT                   /protein_id="YP_004124806.1"
FT   sig_peptide     146738..146803
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT                   /locus_tag="Alide_0132"
FT   misc_feature    146867..147676
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0132"
FT   gene            147693..149267
FT                   /db_xref="GeneID:10102156"
FT                   /locus_tag="Alide_0133"
FT   CDS_pept        147693..149267
FT                   /locus_tag="Alide_0133"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0098 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:319760870"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102156"
FT                   RANPAAH"
FT                   /protein_id="YP_004124807.1"
FT   misc_feature    147741..149240
FT                   /note="long-chain-fatty-acid--CoA ligase; Validated;
FT                   Region: PRK06187"
FT                   /db_xref="CDD:180453"
FT                   /locus_tag="Alide_0133"
FT   misc_feature    <148203..149240
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Alide_0133"
FT   gene            149285..150277
FT                   /db_xref="GeneID:10102157"
FT                   /locus_tag="Alide_0134"
FT   CDS_pept        149285..150277
FT                   /locus_tag="Alide_0134"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0099"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0099 hypothetical protein"
FT                   /db_xref="GI:319760871"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102157"
FT                   /protein_id="YP_004124808.1"
FT   sig_peptide     149285..149377
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT                   /locus_tag="Alide_0134"
FT   misc_feature    149501..150265
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0134"
FT   gene            150290..150745
FT                   /db_xref="GeneID:10102158"
FT                   /locus_tag="Alide_0135"
FT   CDS_pept        150290..150745
FT                   /locus_tag="Alide_0135"
FT                   /gene_family="HOG000066992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dia:Dtpsy_0117 thioesterase superfamily protein"
FT                   /db_xref="GI:319760872"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102158"
FT                   /protein_id="YP_004124809.1"
FT   misc_feature    150398..150724
FT                   /note="PaaI_thioesterase is a tetrameric acyl-CoA
FT                   thioesterase with a hot dog fold and one of several
FT                   proteins responsible for phenylacetic acid (PA) degradation
FT                   in bacteria.  Although orthologs of PaaI exist in archaea
FT                   and eukaryotes, their function has not...; Region:
FT                   PaaI_thioesterase; cd03443"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0135"
FT   misc_feature    order(150479..150481,150566..150568,150587..150598)
FT                   /note="CoenzymeA binding site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0135"
FT   misc_feature    order(150482..150484,150488..150490,150497..150499,
FT                   150569..150583,150587..150589)
FT                   /note="subunit interaction site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0135"
FT   misc_feature    order(150485..150487,150509..150514,150521..150526,
FT                   150566..150568)
FT                   /note="PHB binding site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0135"
FT   gene            complement(150767..151777)
FT                   /db_xref="GeneID:10102159"
FT                   /locus_tag="Alide_0136"
FT   CDS_pept        complement(150767..151777)
FT                   /locus_tag="Alide_0136"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0118"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0118 hypothetical protein"
FT                   /db_xref="GI:319760873"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102159"
FT                   /protein_id="YP_004124810.1"
FT   sig_peptide     complement(151685..151777)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.889 at
FT                   residue 31"
FT                   /locus_tag="Alide_0136"
FT   misc_feature    complement(150782..151612)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0136"
FT   gene            complement(151817..152803)
FT                   /db_xref="GeneID:10102160"
FT                   /locus_tag="Alide_0137"
FT   CDS_pept        complement(151817..152803)
FT                   /locus_tag="Alide_0137"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0119"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0119 hypothetical protein"
FT                   /db_xref="GI:319760874"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102160"
FT                   /protein_id="YP_004124811.1"
FT   sig_peptide     complement(152714..152803)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT                   /locus_tag="Alide_0137"
FT   misc_feature    complement(151829..152647)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0137"
FT   gene            complement(152836..153990)
FT                   /db_xref="GeneID:10102161"
FT                   /locus_tag="Alide_0138"
FT   CDS_pept        complement(152836..153990)
FT                   /locus_tag="Alide_0138"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0103 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760875"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102161"
FT                   /protein_id="YP_004124812.1"
FT   misc_feature    complement(152839..153963)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0138"
FT   misc_feature    complement(152839..153957)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0138"
FT   misc_feature    complement(order(152872..152874,152878..152880,
FT                   152884..152892,153496..153498,153502..153504,
FT                   153607..153609,153613..153615,153703..153705))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0138"
FT   gene            complement(154066..155613)
FT                   /db_xref="GeneID:10102162"
FT                   /locus_tag="Alide_0139"
FT   CDS_pept        complement(154066..155613)
FT                   /locus_tag="Alide_0139"
FT                   /gene_family="HOG000229987" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0104 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:319760876"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102162"
FT                   /protein_id="YP_004124813.1"
FT   misc_feature    complement(154090..155469)
FT                   /note="long-chain-fatty-acid--CoA ligase; Validated;
FT                   Region: PRK08276"
FT                   /db_xref="CDD:181347"
FT                   /locus_tag="Alide_0139"
FT   misc_feature    complement(154102..155466)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Alide_0139"
FT   gene            155819..156997
FT                   /db_xref="GeneID:10102163"
FT                   /locus_tag="Alide_0140"
FT   CDS_pept        155819..156997
FT                   /locus_tag="Alide_0140"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   dia:Dtpsy_0122 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="GI:319760877"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="GeneID:10102163"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_004124814.1"
FT   misc_feature    155819..156994
FT                   /note="acetyl-CoA acetyltransferase; Provisional; Region:
FT                   PRK07801"
FT                   /db_xref="CDD:181123"
FT                   /locus_tag="Alide_0140"
FT   misc_feature    155831..156991
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Alide_0140"
FT   misc_feature    order(155891..155893,155972..155974,156014..156016,
FT                   156026..156028,156038..156040,156071..156082,
FT                   156104..156106,156125..156130,156137..156139,
FT                   156182..156184,156650..156652,156656..156658,
FT                   156662..156664,156722..156724,156959..156964)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Alide_0140"
FT   misc_feature    order(156089..156091,156860..156862,156950..156952)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Alide_0140"
FT   gene            157053..157820
FT                   /db_xref="GeneID:10102164"
FT                   /locus_tag="Alide_0141"
FT   CDS_pept        157053..157820
FT                   /locus_tag="Alide_0141"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ajs:Ajs_0106 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760878"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:10102164"
FT                   /protein_id="YP_004124815.1"
FT   misc_feature    157053..157811
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:180126"
FT                   /locus_tag="Alide_0141"
FT   misc_feature    157053..157808
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0141"
FT   gene            157889..158887
FT                   /db_xref="GeneID:10102165"
FT                   /locus_tag="Alide_0142"
FT   CDS_pept        157889..158887
FT                   /locus_tag="Alide_0142"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0125"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0125 hypothetical protein"
FT                   /db_xref="GI:319760879"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102165"
FT                   /protein_id="YP_004124816.1"
FT   sig_peptide     157889..157987
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.858 at
FT                   residue 33"
FT                   /locus_tag="Alide_0142"
FT   misc_feature    158054..158866
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0142"
FT   gene            158897..159703
FT                   /db_xref="GeneID:10102166"
FT                   /locus_tag="Alide_0143"
FT   CDS_pept        158897..159703
FT                   /locus_tag="Alide_0143"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ajs:Ajs_0109 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760880"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102166"
FT                   /protein_id="YP_004124817.1"
FT   misc_feature    158897..159661
FT                   /note="short chain dehydrogenase; Provisional; Region:
FT                   PRK07576"
FT                   /db_xref="CDD:181043"
FT                   /locus_tag="Alide_0143"
FT   misc_feature    158906..159643
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0143"
FT   gene            159700..159804
FT                   /db_xref="GeneID:10102167"
FT                   /locus_tag="Alide_0144"
FT   CDS_pept        159700..159804
FT                   /locus_tag="Alide_0144"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:319760881"
FT                   /db_xref="GeneID:10102167"
FT                   /protein_id="YP_004124818.1"
FT   gene            159841..160620
FT                   /db_xref="GeneID:10102168"
FT                   /locus_tag="Alide_0145"
FT   CDS_pept        159841..160620
FT                   /locus_tag="Alide_0145"
FT                   /gene_family="HOG000256786" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0128 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760882"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102168"
FT                   /protein_id="YP_004124819.1"
FT   misc_feature    159868..160140
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0145"
FT   misc_feature    159871..160608
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Alide_0145"
FT   misc_feature    160237..160572
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Alide_0145"
FT   gene            160715..161824
FT                   /db_xref="GeneID:10102169"
FT                   /locus_tag="Alide_0146"
FT   CDS_pept        160715..161824
FT                   /locus_tag="Alide_0146"
FT                   /gene_family="HOG000219744" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0112 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760883"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102169"
FT                   /protein_id="YP_004124820.1"
FT   misc_feature    160724..161767
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0146"
FT   gene            complement(161850..162839)
FT                   /db_xref="GeneID:10102170"
FT                   /locus_tag="Alide_0147"
FT   CDS_pept        complement(161850..162839)
FT                   /locus_tag="Alide_0147"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_B1448"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_B1448 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760884"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102170"
FT                   /protein_id="YP_004124821.1"
FT   sig_peptide     complement(162738..162839)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT                   /locus_tag="Alide_0147"
FT   misc_feature    complement(161859..162647)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0147"
FT   gene            complement(162883..163299)
FT                   /db_xref="GeneID:10102171"
FT                   /locus_tag="Alide_0148"
FT   CDS_pept        complement(162883..163299)
FT                   /locus_tag="Alide_0148"
FT                   /gene_family="HOG000229752" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   reh:H16_A2147 hypothetical protein"
FT                   /db_xref="GI:319760885"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="GeneID:10102171"
FT                   /protein_id="YP_004124822.1"
FT   misc_feature    complement(163132..163242)
FT                   /note="Rubredoxin-like zinc ribbon domain (DUF35_N);
FT                   Region: DUF35_N; pfam12172"
FT                   /db_xref="CDD:152607"
FT                   /locus_tag="Alide_0148"
FT   misc_feature    complement(162934..163131)
FT                   /note="DUF35 OB-fold domain; Region: DUF35; pfam01796"
FT                   /db_xref="CDD:145124"
FT                   /locus_tag="Alide_0148"
FT   gene            complement(163301..164461)
FT                   /db_xref="GeneID:10102172"
FT                   /locus_tag="Alide_0149"
FT   CDS_pept        complement(163301..164461)
FT                   /locus_tag="Alide_0149"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2148"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2148 acetyl-CoA acetyltransferase"
FT                   /db_xref="GI:319760886"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:10102172"
FT                   /protein_id="YP_004124823.1"
FT   misc_feature    complement(163307..164461)
FT                   /note="thiolase; Provisional; Region: PRK06158"
FT                   /db_xref="CDD:180434"
FT                   /locus_tag="Alide_0149"
FT   misc_feature    complement(163313..164428)
FT                   /note="Thiolase domain associated with sterol carrier
FT                   protein (SCP)-x isoform and related proteins; SCP-2  has
FT                   multiple roles in intracellular lipid circulation and
FT                   metabolism. The N-terminal presequence in the SCP-x isoform
FT                   represents a peroxisomal 3-ketacyl-; Region:
FT                   SCP-x_thiolase; cd00829"
FT                   /db_xref="CDD:29416"
FT                   /locus_tag="Alide_0149"
FT   misc_feature    complement(order(163454..163456,163604..163606,
FT                   164213..164215))
FT                   /note="active site"
FT                   /db_xref="CDD:29416"
FT                   /locus_tag="Alide_0149"
FT   gene            complement(164484..165641)
FT                   /db_xref="GeneID:10102173"
FT                   /locus_tag="Alide_0150"
FT   CDS_pept        complement(164484..165641)
FT                   /locus_tag="Alide_0150"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reh:H16_A2149 acyl-CoA dehydrogenase,
FT                   long-chain specific"
FT                   /db_xref="GI:319760887"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102173"
FT                   /protein_id="YP_004124824.1"
FT   misc_feature    complement(164487..165602)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0150"
FT   misc_feature    complement(164487..165596)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0150"
FT   misc_feature    complement(order(164520..164522,164526..164528,
FT                   164532..164540,165141..165143,165147..165149,
FT                   165240..165242,165246..165248,165336..165338))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0150"
FT   gene            complement(165676..167217)
FT                   /db_xref="GeneID:10102174"
FT                   /locus_tag="Alide_0151"
FT   CDS_pept        complement(165676..167217)
FT                   /locus_tag="Alide_0151"
FT                   /gene_family="HOG000229987" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reh:H16_A2150 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="GI:319760888"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102174"
FT                   /protein_id="YP_004124825.1"
FT   misc_feature    complement(165697..167175)
FT                   /note="long-chain-fatty-acid--CoA ligase; Validated;
FT                   Region: PRK08276"
FT                   /db_xref="CDD:181347"
FT                   /locus_tag="Alide_0151"
FT   misc_feature    complement(165727..167148)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Alide_0151"
FT   gene            complement(167204..168139)
FT                   /db_xref="GeneID:10102175"
FT                   /locus_tag="Alide_0152"
FT   CDS_pept        complement(167204..168139)
FT                   /locus_tag="Alide_0152"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2151 acyl dehydratase; PFAM: MaoC
FT                   domain protein dehydratase"
FT                   /db_xref="GI:319760889"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102175"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-coahydratase"
FT                   /protein_id="YP_004124826.1"
FT   misc_feature    complement(167243..168082)
FT                   /note="enoyl-CoA hydratase; Region: PLN02864"
FT                   /db_xref="CDD:178455"
FT                   /locus_tag="Alide_0152"
FT   misc_feature    complement(167258..167635)
FT                   /note="HDE_HSD  The R-hydratase-like hot dog fold of the
FT                   17-beta-hydroxysteriod dehydrogenase (HSD), and
FT                   Hydratase-Dehydrogenase-Epimerase (HDE) proteins.  Other
FT                   enzymes with this fold include MaoC dehydratase, and the
FT                   fatty acid synthase beta subunit; Region: HDE_HSD; cd03448"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0152"
FT   misc_feature    complement(order(167537..167539,167549..167551,
FT                   167555..167557,167567..167572,167579..167581,
FT                   167588..167590))
FT                   /note="dimer interaction site; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0152"
FT   misc_feature    complement(order(167267..167269,167285..167287,
FT                   167312..167314,167318..167320,167357..167359,
FT                   167399..167401,167405..167407,167411..167413,
FT                   167420..167422,167456..167458,167468..167470,
FT                   167477..167479,167486..167488,167492..167494,
FT                   167543..167545,167552..167554,167558..167560,
FT                   167576..167578))
FT                   /note="substrate-binding tunnel; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0152"
FT   misc_feature    complement(order(167486..167491,167498..167500,
FT                   167543..167545,167552..167554,167558..167563,
FT                   167573..167575))
FT                   /note="active site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0152"
FT   misc_feature    complement(order(167489..167491,167543..167545,
FT                   167552..167554,167558..167560))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0152"
FT   misc_feature    complement(order(167420..167422,167426..167428,
FT                   167456..167458,167465..167467))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0152"
FT   gene            complement(168157..169080)
FT                   /db_xref="GeneID:10102176"
FT                   /locus_tag="Alide_0153"
FT   CDS_pept        complement(168157..169080)
FT                   /locus_tag="Alide_0153"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   reh:H16_A2152 short chain dehydrogenase"
FT                   /db_xref="GI:319760890"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:10102176"
FT                   /protein_id="YP_004124827.1"
FT   misc_feature    complement(168307..169062)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Alide_0153"
FT   misc_feature    complement(168232..169059)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0153"
FT   gene            complement(169106..170089)
FT                   /db_xref="GeneID:10102177"
FT                   /locus_tag="Alide_0154"
FT   CDS_pept        complement(169106..170089)
FT                   /locus_tag="Alide_0154"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2153"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2153 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760891"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102177"
FT                   /protein_id="YP_004124828.1"
FT   sig_peptide     complement(170009..170089)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.883 at
FT                   residue 27"
FT                   /locus_tag="Alide_0154"
FT   misc_feature    complement(169115..169930)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0154"
FT   gene            170319..171104
FT                   /db_xref="GeneID:10102178"
FT                   /locus_tag="Alide_0155"
FT   CDS_pept        170319..171104
FT                   /locus_tag="Alide_0155"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2154 IclR family transcriptional
FT                   regulator; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760892"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102178"
FT                   /protein_id="YP_004124829.1"
FT   misc_feature    170334..171068
FT                   /note="beta-ketoadipate pathway transcriptional regulators,
FT                   PcaR/PcaU/PobR family; Region: pcaR_pcaU; TIGR02431"
FT                   /db_xref="CDD:131484"
FT                   /locus_tag="Alide_0155"
FT   misc_feature    170346..170612
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0155"
FT   misc_feature    170715..171068
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Alide_0155"
FT   gene            complement(171124..172380)
FT                   /db_xref="GeneID:10102179"
FT                   /locus_tag="Alide_0156"
FT   CDS_pept        complement(171124..172380)
FT                   /locus_tag="Alide_0156"
FT                   /gene_family="HOG000225587" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0113 major facilitator superfamily
FT                   transporter; manually curated; PFAM: major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="GI:319760893"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102179"
FT                   /protein_id="YP_004124830.1"
FT   misc_feature    complement(171274..172299)
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="Alide_0156"
FT   gene            complement(172421..173284)
FT                   /db_xref="GeneID:10102180"
FT                   /locus_tag="Alide_0157"
FT   CDS_pept        complement(172421..173284)
FT                   /locus_tag="Alide_0157"
FT                   /gene_family="HOG000242281" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0131 HpcH/HpaI aldolase; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="GI:319760894"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="GeneID:10102180"
FT                   AQRRSA"
FT                   /product="citryl-CoA lyase"
FT                   /protein_id="YP_004124831.1"
FT   misc_feature    complement(172424..173257)
FT                   /note="Malate synthase catalyzes the Claisen condensation
FT                   of glyoxylate and acetyl-CoA to malyl-CoA , which
FT                   hydrolyzes to malate and CoA. This reaction is part of the
FT                   glyoxylate cycle, which allows certain organisms, like
FT                   plants and fungi, to derive their...; Region: malate_synt;
FT                   cl09155"
FT                   /db_xref="CDD:186842"
FT                   /locus_tag="Alide_0157"
FT   gene            complement(173317..175637)
FT                   /db_xref="GeneID:10102181"
FT                   /locus_tag="Alide_0158"
FT                   /pseudo
FT   gene            complement(173667..174755)
FT                   /db_xref="GeneID:10102182"
FT                   /locus_tag="Alide_0159"
FT   CDS_pept        complement(173667..174755)
FT                   /locus_tag="Alide_0159"
FT                   /gene_family="HOG000220006" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase is4 family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_3918 transposase, IS4 family protein;
FT                   manually curated; PFAM: transposase IS4 family protein"
FT                   /db_xref="GI:319760895"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004803"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:10102182"
FT                   /protein_id="YP_004124832.1"
FT   misc_feature    complement(174372..174599)
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Alide_0159"
FT   misc_feature    complement(173715..174116)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Alide_0159"
FT   gene            complement(175711..177096)
FT                   /db_xref="GeneID:10102183"
FT                   /locus_tag="Alide_0160"
FT   CDS_pept        complement(175711..177096)
FT                   /locus_tag="Alide_0160"
FT                   /gene_family="HOG000267405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /codon_start="1"
FT                   /product="mmge/prpd family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: dia:Dtpsy_0134
FT                   MmgE/PrpD family protein"
FT                   /db_xref="GI:319760896"
FT                   /db_xref="GO:0047547"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="GeneID:10102183"
FT                   AGA"
FT                   /protein_id="YP_004124833.1"
FT   misc_feature    complement(175750..177063)
FT                   /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
FT                   /db_xref="CDD:186254"
FT                   /locus_tag="Alide_0160"
FT   gene            complement(177147..178328)
FT                   /db_xref="GeneID:10102184"
FT                   /locus_tag="Alide_0161"
FT   CDS_pept        complement(177147..178328)
FT                   /locus_tag="Alide_0161"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0117 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760897"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102184"
FT                   /protein_id="YP_004124834.1"
FT   misc_feature    complement(177162..178328)
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0161"
FT   gene            complement(178339..179505)
FT                   /db_xref="GeneID:10102185"
FT                   /locus_tag="Alide_0162"
FT   CDS_pept        complement(178339..179505)
FT                   /locus_tag="Alide_0162"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: dac:Daci_0198 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760898"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102185"
FT                   /protein_id="YP_004124835.1"
FT   misc_feature    complement(178342..179472)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0162"
FT   misc_feature    complement(178357..179472)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0162"
FT   misc_feature    complement(order(178393..178395,178399..178401,
FT                   178405..178413,179032..179034,179038..179040,
FT                   179131..179133,179137..179139,179233..179235))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0162"
FT   gene            complement(179579..180472)
FT                   /db_xref="GeneID:10102186"
FT                   /locus_tag="Alide_0163"
FT   CDS_pept        complement(179579..180472)
FT                   /locus_tag="Alide_0163"
FT                   /gene_family="HOG000267416" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0137"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0137 hypothetical protein"
FT                   /db_xref="GI:319760899"
FT                   /db_xref="GeneID:10102186"
FT                   QDHEGFLTMQGMATLA"
FT                   /protein_id="YP_004124836.1"
FT   misc_feature    complement(179588..180424)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3777"
FT                   /db_xref="CDD:33572"
FT                   /locus_tag="Alide_0163"
FT   misc_feature    complement(179582..179926)
FT                   /note="The hotdog fold was initially identified in the E.
FT                   coli FabA (beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase) structure and subsequently in 4HBT
FT                   (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
FT                   number of other seemingly unrelated...; Region: hot_dog;
FT                   cl00509"
FT                   /db_xref="CDD:186045"
FT                   /locus_tag="Alide_0163"
FT   misc_feature    complement(order(179702..179713,179792..179797))
FT                   /note="active site 2"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="Alide_0163"
FT   misc_feature    complement(order(179729..179737,179756..179758,
FT                   179765..179770,179777..179779))
FT                   /note="active site 1"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="Alide_0163"
FT   gene            180657..181574
FT                   /db_xref="GeneID:10102187"
FT                   /locus_tag="Alide_0164"
FT   CDS_pept        180657..181574
FT                   /locus_tag="Alide_0164"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dia:Dtpsy_0138 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760900"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:10102187"
FT                   /protein_id="YP_004124837.1"
FT   misc_feature    180756..181496
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0164"
FT   misc_feature    180798..181406
FT                   /note="short chain dehydrogenase; Provisional; Region:
FT                   PRK07060"
FT                   /db_xref="CDD:180817"
FT                   /locus_tag="Alide_0164"
FT   gene            181578..182471
FT                   /db_xref="GeneID:10102188"
FT                   /locus_tag="Alide_0165"
FT   CDS_pept        181578..182471
FT                   /locus_tag="Alide_0165"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0121 dehydratase; PFAM: MaoC domain
FT                   protein dehydratase"
FT                   /db_xref="GI:319760901"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102188"
FT                   AERDKVVLSHGYAELA"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-coahydratase"
FT                   /protein_id="YP_004124838.1"
FT   misc_feature    181581..182465
FT                   /note="enoyl-CoA hydratase; Region: PLN02864"
FT                   /db_xref="CDD:178455"
FT                   /locus_tag="Alide_0165"
FT   misc_feature    182097..182468
FT                   /note="HDE_HSD  The R-hydratase-like hot dog fold of the
FT                   17-beta-hydroxysteriod dehydrogenase (HSD), and
FT                   Hydratase-Dehydrogenase-Epimerase (HDE) proteins.  Other
FT                   enzymes with this fold include MaoC dehydratase, and the
FT                   fatty acid synthase beta subunit; Region: HDE_HSD; cd03448"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0165"
FT   misc_feature    order(182139..182141,182148..182150,182157..182162,
FT                   182172..182174,182178..182180,182190..182192)
FT                   /note="dimer interaction site; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0165"
FT   misc_feature    order(182151..182153,182169..182171,182175..182177,
FT                   182184..182186,182235..182237,182241..182243,
FT                   182250..182252,182259..182261,182271..182273,
FT                   182307..182309,182316..182318,182322..182324,
FT                   182328..182330,182370..182372,182406..182408,
FT                   182412..182414,182439..182441,182457..182459)
FT                   /note="substrate-binding tunnel; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0165"
FT   misc_feature    order(182154..182156,182166..182171,182175..182177,
FT                   182184..182186,182229..182231,182238..182243)
FT                   /note="active site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0165"
FT   misc_feature    order(182169..182171,182175..182177,182184..182186,
FT                   182238..182240)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0165"
FT   misc_feature    order(182262..182264,182271..182273,182301..182303,
FT                   182307..182309)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48043"
FT                   /locus_tag="Alide_0165"
FT   gene            182553..183347
FT                   /db_xref="GeneID:10102189"
FT                   /locus_tag="Alide_0166"
FT   CDS_pept        182553..183347
FT                   /locus_tag="Alide_0166"
FT                   /gene_family="HOG000027949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   dia:Dtpsy_0140 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="GI:319760902"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="GeneID:10102189"
FT                   /protein_id="YP_004124839.1"
FT   misc_feature    182568..183329
FT                   /note="enoyl-CoA hydratase; Provisional; Region: PRK06688"
FT                   /db_xref="CDD:180658"
FT                   /locus_tag="Alide_0166"
FT   misc_feature    182568..183113
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0166"
FT   misc_feature    order(182625..182627,182631..182633,182727..182729,
FT                   182739..182753,182874..182876,182880..182888,
FT                   182952..182957,182964..182966)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0166"
FT   misc_feature    order(182745..182747,182886..182888)
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0166"
FT   misc_feature    order(182826..182828,182850..182852,182913..182924,
FT                   182958..182969,182985..182987,182991..182999,
FT                   183003..183008,183021..183026,183030..183035,
FT                   183039..183044,183051..183053,183084..183086,
FT                   183093..183095)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0166"
FT   gene            183484..184767
FT                   /db_xref="GeneID:10102190"
FT                   /locus_tag="Alide_0167"
FT   CDS_pept        183484..184767
FT                   /locus_tag="Alide_0167"
FT                   /gene_family="HOG000223272" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02550"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ajs:Ajs_0123 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="GI:319760903"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="GeneID:10102190"
FT                   /protein_id="YP_004124840.1"
FT   misc_feature    183484..183951
FT                   /note="Acetyl-CoA hydrolase/transferase N-terminal domain;
FT                   Region: AcetylCoA_hydro; pfam02550"
FT                   /db_xref="CDD:111448"
FT                   /locus_tag="Alide_0167"
FT   misc_feature    183496..184761
FT                   /note="Acetyl-CoA hydrolase [Energy production and
FT                   conversion]; Region: ACH1; COG0427"
FT                   /db_xref="CDD:30776"
FT                   /locus_tag="Alide_0167"
FT   gene            184834..186042
FT                   /db_xref="GeneID:10102191"
FT                   /locus_tag="Alide_0168"
FT   CDS_pept        184834..186042
FT                   /locus_tag="Alide_0168"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   ajs:Ajs_0124 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="GI:319760904"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="GeneID:10102191"
FT                   ERV"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_004124841.1"
FT   misc_feature    184834..186039
FT                   /note="acetyl-CoA acetyltransferase; Provisional; Region:
FT                   PRK06205"
FT                   /db_xref="CDD:180468"
FT                   /locus_tag="Alide_0168"
FT   misc_feature    184846..186036
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Alide_0168"
FT   misc_feature    order(184900..184902,184981..184983,185023..185025,
FT                   185032..185034,185044..185046,185077..185088,
FT                   185110..185112,185131..185136,185143..185145,
FT                   185188..185190,185680..185682,185686..185688,
FT                   185692..185694,185752..185754,186004..186009)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Alide_0168"
FT   misc_feature    order(185095..185097,185905..185907,185995..185997)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Alide_0168"
FT   gene            complement(186057..186980)
FT                   /db_xref="GeneID:10102192"
FT                   /locus_tag="Alide_0169"
FT   CDS_pept        complement(186057..186980)
FT                   /locus_tag="Alide_0169"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_0188 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760905"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102192"
FT                   /protein_id="YP_004124842.1"
FT   misc_feature    complement(186081..186980)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0169"
FT   misc_feature    complement(186795..186974)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0169"
FT   misc_feature    complement(186111..186710)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Alide_0169"
FT   misc_feature    complement(order(186174..186176,186261..186263,
FT                   186312..186314,186501..186503,186507..186509,
FT                   186549..186551,186666..186668,186678..186680))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Alide_0169"
FT   misc_feature    complement(order(186285..186287,186294..186299,
FT                   186318..186332,186417..186419,186603..186623,
FT                   186627..186629,186639..186641,186648..186653,
FT                   186657..186662,186672..186677))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Alide_0169"
FT   gene            187158..188342
FT                   /db_xref="GeneID:10102193"
FT                   /locus_tag="Alide_0170"
FT   CDS_pept        187158..188342
FT                   /locus_tag="Alide_0170"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dac:Daci_0189 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760906"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102193"
FT                   /protein_id="YP_004124843.1"
FT   misc_feature    187188..188306
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0170"
FT   gene            188357..189382
FT                   /db_xref="GeneID:10102194"
FT                   /locus_tag="Alide_0171"
FT   CDS_pept        188357..189382
FT                   /locus_tag="Alide_0171"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dac:Daci_0190 alcohol dehydrogenase"
FT                   /db_xref="GI:319760907"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:10102194"
FT                   P"
FT                   /protein_id="YP_004124844.1"
FT   misc_feature    188366..189364
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="Alide_0171"
FT   misc_feature    188366..189358
FT                   /note="Quinone oxidoreductase (QOR); Region: QOR1; cd08241"
FT                   /db_xref="CDD:176203"
FT                   /locus_tag="Alide_0171"
FT   misc_feature    order(188489..188494,188735..188737,188747..188749,
FT                   188810..188812,188819..188827,188885..188890,
FT                   188900..188902,189011..189013,189077..189082,
FT                   189086..189091,189152..189160,189332..189334,
FT                   189338..189340,189344..189346)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:176203"
FT                   /locus_tag="Alide_0171"
FT   gene            189379..190404
FT                   /db_xref="GeneID:10102195"
FT                   /locus_tag="Alide_0172"
FT   CDS_pept        189379..190404
FT                   /locus_tag="Alide_0172"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0191"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0191 hypothetical protein"
FT                   /db_xref="GI:319760908"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102195"
FT                   D"
FT                   /protein_id="YP_004124845.1"
FT   sig_peptide     189379..189504
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.955 at
FT                   residue 42"
FT                   /locus_tag="Alide_0172"
FT   misc_feature    189571..190392
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0172"
FT   gene            complement(190435..191343)
FT                   /db_xref="GeneID:10102196"
FT                   /locus_tag="Alide_0173"
FT   CDS_pept        complement(190435..191343)
FT                   /locus_tag="Alide_0173"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: aav:Aave_3679 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760909"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102196"
FT                   /protein_id="YP_004124846.1"
FT   misc_feature    complement(190465..191328)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:182990"
FT                   /locus_tag="Alide_0173"
FT   misc_feature    complement(191143..191313)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0173"
FT   misc_feature    complement(190477..191055)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Alide_0173"
FT   misc_feature    complement(order(190954..190974,190978..191031,
FT                   191035..191055))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Alide_0173"
FT   misc_feature    complement(order(190612..190614,190672..190680,
FT                   191029..191031,191035..191040))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Alide_0173"
FT   gene            191452..192435
FT                   /db_xref="GeneID:10102197"
FT                   /locus_tag="Alide_0174"
FT   CDS_pept        191452..192435
FT                   /locus_tag="Alide_0174"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_3678"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_3678 hypothetical protein"
FT                   /db_xref="GI:319760910"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102197"
FT                   /protein_id="YP_004124847.1"
FT   sig_peptide     191452..191529
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.890 at
FT                   residue 26"
FT                   /locus_tag="Alide_0174"
FT   misc_feature    191599..192423
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0174"
FT   gene            192432..193631
FT                   /db_xref="GeneID:10102198"
FT                   /locus_tag="Alide_0175"
FT   CDS_pept        192432..193631
FT                   /locus_tag="Alide_0175"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: aav:Aave_3677
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="GI:319760911"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:10102198"
FT                   "
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_004124848.1"
FT   misc_feature    192468..193625
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="Alide_0175"
FT   misc_feature    <192501..193625
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:186834"
FT                   /locus_tag="Alide_0175"
FT   gene            193811..194791
FT                   /db_xref="GeneID:10102199"
FT                   /locus_tag="Alide_0176"
FT   CDS_pept        193811..194791
FT                   /locus_tag="Alide_0176"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0125"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0125 hypothetical protein"
FT                   /db_xref="GI:319760912"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102199"
FT                   /protein_id="YP_004124849.1"
FT   sig_peptide     193811..193894
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT                   /locus_tag="Alide_0176"
FT   misc_feature    193955..194773
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0176"
FT   gene            194793..196301
FT                   /db_xref="GeneID:10102200"
FT                   /locus_tag="Alide_0177"
FT   CDS_pept        194793..196301
FT                   /locus_tag="Alide_0177"
FT                   /gene_family="HOG000229983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dia:Dtpsy_0144 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:319760913"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102200"
FT                   /protein_id="YP_004124850.1"
FT   misc_feature    194802..196295
FT                   /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
FT                   II [Lipid metabolism / Secondary metabolites biosynthesis,
FT                   transport, and catabolism]; Region: CaiC; COG0318"
FT                   /db_xref="CDD:30666"
FT                   /locus_tag="Alide_0177"
FT   misc_feature    194928..196286
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Alide_0177"
FT   gene            196319..197302
FT                   /db_xref="GeneID:10102201"
FT                   /locus_tag="Alide_0178"
FT   CDS_pept        196319..197302
FT                   /locus_tag="Alide_0178"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0145"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0145 hypothetical protein"
FT                   /db_xref="GI:319760914"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102201"
FT                   /protein_id="YP_004124851.1"
FT   sig_peptide     196319..196402
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 28"
FT                   /locus_tag="Alide_0178"
FT   misc_feature    196472..197290
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0178"
FT   gene            complement(197357..198358)
FT                   /db_xref="GeneID:10102202"
FT                   /locus_tag="Alide_0179"
FT   CDS_pept        complement(197357..198358)
FT                   /locus_tag="Alide_0179"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_B1474"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_B1474 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760915"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102202"
FT                   /protein_id="YP_004124852.1"
FT   sig_peptide     complement(198278..198358)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT                   /locus_tag="Alide_0179"
FT   misc_feature    complement(197378..198208)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0179"
FT   gene            complement(198379..199560)
FT                   /db_xref="GeneID:10102203"
FT                   /locus_tag="Alide_0180"
FT   CDS_pept        complement(198379..199560)
FT                   /locus_tag="Alide_0180"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; manually curated; KEGG: reu:Reut_B4300 peptidase
FT                   M20D, amidohydrolase; TIGRFAM: amidohydrolase"
FT                   /db_xref="GI:319760916"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:10102203"
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_004124853.1"
FT   misc_feature    complement(198394..199527)
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="Alide_0180"
FT   misc_feature    complement(198382..>199497)
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:186834"
FT                   /locus_tag="Alide_0180"
FT   gene            199825..200244
FT                   /db_xref="GeneID:10102204"
FT                   /locus_tag="Alide_0181"
FT   CDS_pept        199825..200244
FT                   /locus_tag="Alide_0181"
FT                   /gene_family="HOG000229752" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   ajs:Ajs_0128 hypothetical protein"
FT                   /db_xref="GI:319760917"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="GeneID:10102204"
FT                   /protein_id="YP_004124854.1"
FT   misc_feature    199897..199998
FT                   /note="Rubredoxin-like zinc ribbon domain (DUF35_N);
FT                   Region: DUF35_N; pfam12172"
FT                   /db_xref="CDD:152607"
FT                   /locus_tag="Alide_0181"
FT   misc_feature    199999..200175
FT                   /note="DUF35 OB-fold domain; Region: DUF35; pfam01796"
FT                   /db_xref="CDD:145124"
FT                   /locus_tag="Alide_0181"
FT   gene            200241..201449
FT                   /db_xref="GeneID:10102205"
FT                   /locus_tag="Alide_0182"
FT   CDS_pept        200241..201449
FT                   /locus_tag="Alide_0182"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0129"
FT                   /codon_start="1"
FT                   /product="thiolase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0129 thiolase"
FT                   /db_xref="GI:319760918"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:10102205"
FT                   ETL"
FT                   /protein_id="YP_004124855.1"
FT   misc_feature    200277..201446
FT                   /note="thiolase; Provisional; Region: PRK06158"
FT                   /db_xref="CDD:180434"
FT                   /locus_tag="Alide_0182"
FT   misc_feature    200313..201425
FT                   /note="Thiolase domain associated with sterol carrier
FT                   protein (SCP)-x isoform and related proteins; SCP-2  has
FT                   multiple roles in intracellular lipid circulation and
FT                   metabolism. The N-terminal presequence in the SCP-x isoform
FT                   represents a peroxisomal 3-ketacyl-; Region:
FT                   SCP-x_thiolase; cd00829"
FT                   /db_xref="CDD:29416"
FT                   /locus_tag="Alide_0182"
FT   misc_feature    order(200529..200531,201132..201134,201282..201284)
FT                   /note="active site"
FT                   /db_xref="CDD:29416"
FT                   /locus_tag="Alide_0182"
FT   gene            201469..202626
FT                   /db_xref="GeneID:10102206"
FT                   /locus_tag="Alide_0183"
FT   CDS_pept        201469..202626
FT                   /locus_tag="Alide_0183"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: dia:Dtpsy_0148 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="GI:319760919"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102206"
FT                   /protein_id="YP_004124856.1"
FT   misc_feature    201481..202620
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0183"
FT   misc_feature    201484..202608
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0183"
FT   misc_feature    order(201742..201744,201832..201834,201838..201840,
FT                   201931..201933,201937..201939,202552..202560,
FT                   202564..202566,202570..202572)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0183"
FT   gene            202623..203054
FT                   /db_xref="GeneID:10102207"
FT                   /locus_tag="Alide_0184"
FT   CDS_pept        202623..203054
FT                   /locus_tag="Alide_0184"
FT                   /gene_family="HOG000066992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dac:Daci_0175 thioesterase superfamily protein"
FT                   /db_xref="GI:319760920"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102207"
FT                   /protein_id="YP_004124857.1"
FT   misc_feature    202668..203006
FT                   /note="PaaI_thioesterase is a tetrameric acyl-CoA
FT                   thioesterase with a hot dog fold and one of several
FT                   proteins responsible for phenylacetic acid (PA) degradation
FT                   in bacteria.  Although orthologs of PaaI exist in archaea
FT                   and eukaryotes, their function has not...; Region:
FT                   PaaI_thioesterase; cd03443"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0184"
FT   misc_feature    order(202761..202763,202851..202853,202872..202883)
FT                   /note="CoenzymeA binding site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0184"
FT   misc_feature    order(202764..202766,202770..202772,202779..202781,
FT                   202854..202868,202872..202874)
FT                   /note="subunit interaction site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0184"
FT   misc_feature    order(202767..202769,202791..202796,202803..202808,
FT                   202851..202853)
FT                   /note="PHB binding site; other site"
FT                   /db_xref="CDD:48038"
FT                   /locus_tag="Alide_0184"
FT   gene            complement(203051..203800)
FT                   /db_xref="GeneID:10102208"
FT                   /locus_tag="Alide_0185"
FT   CDS_pept        complement(203051..203800)
FT                   /locus_tag="Alide_0185"
FT                   /gene_family="HOG000142058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_2216 regulatory proteins, IclR; PFAM:
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760921"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102208"
FT                   /protein_id="YP_004124858.1"
FT   misc_feature    complement(203075..203770)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Alide_0185"
FT   misc_feature    complement(203498..203770)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0185"
FT   gene            203931..204917
FT                   /db_xref="GeneID:10102209"
FT                   /locus_tag="Alide_0186"
FT   CDS_pept        203931..204917
FT                   /locus_tag="Alide_0186"
FT                   /gene_family="HOG000126605" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10518"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Twin-arginine translocation pathway, signal
FT                   sequence, subgroup; KEGG: vei:Veis_2212 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760922"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="GeneID:10102209"
FT                   /protein_id="YP_004124859.1"
FT   sig_peptide     203931..204014
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.740 at
FT                   residue 28"
FT                   /locus_tag="Alide_0186"
FT   misc_feature    204024..204896
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0186"
FT   gene            204914..205774
FT                   /db_xref="GeneID:10102210"
FT                   /locus_tag="Alide_0187"
FT   CDS_pept        204914..205774
FT                   /locus_tag="Alide_0187"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vei:Veis_2211 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760923"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102210"
FT                   GFLES"
FT                   /protein_id="YP_004124860.1"
FT   misc_feature    204944..205675
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0187"
FT   misc_feature    204944..205675
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Alide_0187"
FT   gene            205774..206922
FT                   /db_xref="GeneID:10102211"
FT                   /locus_tag="Alide_0188"
FT   CDS_pept        205774..206922
FT                   /locus_tag="Alide_0188"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reu:Reut_B5206 acyl-CoA dehydrogenase,
FT                   C-terminal:acyl-CoA dehydrogenase, central region:acyl-CoA
FT                   dehydrogenase, N-terminal"
FT                   /db_xref="GI:319760924"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102211"
FT                   /protein_id="YP_004124861.1"
FT   misc_feature    205801..206919
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0188"
FT   misc_feature    205807..206916
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0188"
FT   misc_feature    order(206065..206067,206155..206157,206161..206163,
FT                   206254..206256,206260..206262,206860..206868,
FT                   206872..206874,206878..206880)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0188"
FT   gene            206972..208591
FT                   /db_xref="GeneID:10102212"
FT                   /locus_tag="Alide_0189"
FT   CDS_pept        206972..208591
FT                   /locus_tag="Alide_0189"
FT                   /gene_family="HOG000218692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4463 propionyl-CoA carboxylase;
FT                   PFAM: carboxyl transferase"
FT                   /db_xref="GI:319760925"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="GeneID:10102212"
FT                   /product="methylcrotonoyl-CoA carboxylase"
FT                   /protein_id="YP_004124862.1"
FT   misc_feature    207005..208588
FT                   /note="3-methylcrotonyl-CoA carboxylase, beta chain;
FT                   Region: PLN02820"
FT                   /db_xref="CDD:178415"
FT                   /locus_tag="Alide_0189"
FT   misc_feature    <207254..>207586
FT                   /note="Acetyl co-enzyme A carboxylase carboxyltransferase
FT                   alpha subunit; Region: ACCA; cl00513"
FT                   /db_xref="CDD:186049"
FT                   /locus_tag="Alide_0189"
FT   misc_feature    <207914..>208249
FT                   /note="Acetyl co-enzyme A carboxylase carboxyltransferase
FT                   alpha subunit; Region: ACCA; cl00513"
FT                   /db_xref="CDD:186049"
FT                   /locus_tag="Alide_0189"
FT   gene            208602..209765
FT                   /db_xref="GeneID:10102213"
FT                   /locus_tag="Alide_0190"
FT   CDS_pept        208602..209765
FT                   /locus_tag="Alide_0190"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reu:Reut_B4462 acyl-CoA dehydrogenase,
FT                   C-terminal:acyl-CoA dehydrogenase, central region:acyl-CoA
FT                   dehydrogenase, N-terminal"
FT                   /db_xref="GI:319760926"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102213"
FT                   /protein_id="YP_004124863.1"
FT   misc_feature    208602..209750
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0190"
FT   misc_feature    208614..209744
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0190"
FT   misc_feature    order(208878..208880,208968..208970,208974..208976,
FT                   209067..209069,209073..209075,209688..209696,
FT                   209700..209702,209706..209708)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0190"
FT   gene            209767..210588
FT                   /db_xref="GeneID:10102214"
FT                   /locus_tag="Alide_0191"
FT   CDS_pept        209767..210588
FT                   /locus_tag="Alide_0191"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vei:Veis_2207 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="GI:319760927"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102214"
FT                   /protein_id="YP_004124864.1"
FT   misc_feature    209785..>210207
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0191"
FT   misc_feature    order(209842..209844,209848..209850,209944..209946,
FT                   209956..209970,210103..210105,210109..210117,
FT                   210181..210186,210193..210195)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0191"
FT   misc_feature    order(209962..209964,210115..210117)
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Alide_0191"
FT   gene            210602..212596
FT                   /db_xref="GeneID:10102215"
FT                   /locus_tag="Alide_0192"
FT   CDS_pept        210602..212596
FT                   /locus_tag="Alide_0192"
FT                   /gene_family="HOG000008989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /codon_start="1"
FT                   /product="carbamoyl-phosphate synthase l chain ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   reu:Reut_B4460 carbamoyl-phosphate synthase subunit L"
FT                   /db_xref="GI:319760928"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:10102215"
FT                   /protein_id="YP_004124865.1"
FT   misc_feature    210629..212587
FT                   /note="Acetyl/propionyl-CoA carboxylase, alpha subunit
FT                   [Lipid metabolism]; Region: COG4770"
FT                   /db_xref="CDD:34383"
FT                   /locus_tag="Alide_0192"
FT   misc_feature    210629..210955
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Alide_0192"
FT   misc_feature    210971..211594
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Alide_0192"
FT   misc_feature    211631..211954
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Alide_0192"
FT   misc_feature    212381..212581
FT                   /note="The biotinyl-domain or biotin carboxyl carrier
FT                   protein (BCCP) domain is present in all biotin-dependent
FT                   enzymes, such as acetyl-CoA carboxylase, pyruvate
FT                   carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
FT                   carboxylase, geranyl-CoA carboxylase...; Region:
FT                   biotinyl_domain; cd06850"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Alide_0192"
FT   misc_feature    order(212450..212452,212477..212485,212504..212506)
FT                   /note="carboxyltransferase (CT) interaction site; other
FT                   site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Alide_0192"
FT   misc_feature    212480..212482
FT                   /note="biotinylation site; other site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Alide_0192"
FT   gene            212593..214407
FT                   /db_xref="GeneID:10102216"
FT                   /locus_tag="Alide_0193"
FT   CDS_pept        212593..214407
FT                   /locus_tag="Alide_0193"
FT                   /gene_family="HOG000258966" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reu:Reut_B4459 hypothetical protein"
FT                   /db_xref="GI:319760929"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="GeneID:10102216"
FT                   /protein_id="YP_004124866.1"
FT   misc_feature    212614..213591
FT                   /note="Protein of unknown function (DUF1446); Region:
FT                   DUF1446; pfam07287"
FT                   /db_xref="CDD:148728"
FT                   /locus_tag="Alide_0193"
FT   gene            214431..215411
FT                   /db_xref="GeneID:10102217"
FT                   /locus_tag="Alide_0194"
FT   CDS_pept        214431..215411
FT                   /locus_tag="Alide_0194"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B4458"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4458 hypothetical protein"
FT                   /db_xref="GI:319760930"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102217"
FT                   /protein_id="YP_004124867.1"
FT   sig_peptide     214431..214511
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT                   /locus_tag="Alide_0194"
FT   misc_feature    214578..215399
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0194"
FT   gene            215419..216639
FT                   /db_xref="GeneID:10102218"
FT                   /locus_tag="Alide_0195"
FT   CDS_pept        215419..216639
FT                   /locus_tag="Alide_0195"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: vei:Veis_2206 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760931"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102218"
FT                   LRKRAII"
FT                   /protein_id="YP_004124868.1"
FT   misc_feature    215419..216636
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0195"
FT   gene            complement(216685..217602)
FT                   /db_xref="GeneID:10102219"
FT                   /locus_tag="Alide_0196"
FT   CDS_pept        complement(216685..217602)
FT                   /locus_tag="Alide_0196"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dia:Dtpsy_0150 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:319760932"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102219"
FT                   /protein_id="YP_004124869.1"
FT   misc_feature    complement(216697..217590)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0196"
FT   misc_feature    complement(217405..217584)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0196"
FT   misc_feature    complement(216724..217317)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator,
FT                   contains the type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_like_1; cd08421"
FT                   /db_xref="CDD:176113"
FT                   /locus_tag="Alide_0196"
FT   misc_feature    complement(order(216892..216897,216901..216906,
FT                   216922..216939,217213..217233,217237..217239,
FT                   217249..217251,217258..217263,217267..217272))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176113"
FT                   /locus_tag="Alide_0196"
FT   gene            217712..218989
FT                   /db_xref="GeneID:10102220"
FT                   /locus_tag="Alide_0197"
FT   CDS_pept        217712..218989
FT                   /locus_tag="Alide_0197"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dia:Dtpsy_0151 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="GI:319760933"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102220"
FT                   /protein_id="YP_004124870.1"
FT   misc_feature    217754..218986
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0197"
FT   gene            complement(219041..219940)
FT                   /db_xref="GeneID:10102221"
FT                   /locus_tag="Alide_0198"
FT   CDS_pept        complement(219041..219940)
FT                   /locus_tag="Alide_0198"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ctt:CtCNB1_0218 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:319760934"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102221"
FT                   AHAQALMAAVQAHHAARA"
FT                   /protein_id="YP_004124871.1"
FT   misc_feature    complement(219098..219934)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0198"
FT   misc_feature    complement(219749..219928)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0198"
FT   misc_feature    complement(219098..219661)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator,
FT                   contains the type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_like_1; cd08421"
FT                   /db_xref="CDD:176113"
FT                   /locus_tag="Alide_0198"
FT   misc_feature    complement(order(219236..219241,219245..219250,
FT                   219266..219283,219557..219577,219581..219583,
FT                   219593..219595,219602..219607,219611..219616))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176113"
FT                   /locus_tag="Alide_0198"
FT   gene            220078..221091
FT                   /db_xref="GeneID:10102222"
FT                   /locus_tag="Alide_0199"
FT   CDS_pept        220078..221091
FT                   /locus_tag="Alide_0199"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_0219"
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_0219 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="GI:319760935"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102222"
FT                   /protein_id="YP_004124872.1"
FT   sig_peptide     220078..220176
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.960 at
FT                   residue 33"
FT                   /locus_tag="Alide_0199"
FT   misc_feature    220243..221079
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0199"
FT   gene            221223..222413
FT                   /db_xref="GeneID:10102223"
FT                   /locus_tag="Alide_0200"
FT   CDS_pept        221223..222413
FT                   /locus_tag="Alide_0200"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0117 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760936"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102223"
FT                   /protein_id="YP_004124873.1"
FT   misc_feature    221223..222386
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0200"
FT   gene            complement(222438..223730)
FT                   /db_xref="GeneID:10102224"
FT                   /locus_tag="Alide_0201"
FT   CDS_pept        complement(222438..223730)
FT                   /locus_tag="Alide_0201"
FT                   /gene_family="HOG000243801" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /codon_start="1"
FT                   /product="glu/leu/phe/val dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   dia:Dtpsy_0153 Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="GI:319760937"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="GeneID:10102224"
FT                   /protein_id="YP_004124874.1"
FT   misc_feature    complement(222444..223676)
FT                   /note="Glutamate dehydrogenase/leucine dehydrogenase [Amino
FT                   acid transport and metabolism]; Region: GdhA; COG0334"
FT                   /db_xref="CDD:30682"
FT                   /locus_tag="Alide_0201"
FT   misc_feature    complement(223200..223586)
FT                   /note="Glu/Leu/Phe/Val dehydrogenase, dimerization domain;
FT                   Region: ELFV_dehydrog_N; pfam02812"
FT                   /db_xref="CDD:145786"
FT                   /locus_tag="Alide_0201"
FT   misc_feature    complement(222474..223148)
FT                   /note="NAD(P) binding domain of glutamate dehydrogenase,
FT                   subgroup 1; Region: NAD_bind_1_Glu_DH; cd01076"
FT                   /db_xref="CDD:133445"
FT                   /locus_tag="Alide_0201"
FT   misc_feature    complement(order(222738..222746,222804..222809,
FT                   222960..222965,223023..223031))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133445"
FT                   /locus_tag="Alide_0201"
FT   gene            223917..224366
FT                   /db_xref="GeneID:10102225"
FT                   /locus_tag="Alide_0202"
FT   CDS_pept        223917..224366
FT                   /locus_tag="Alide_0202"
FT                   /gene_family="HOG000218246" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /codon_start="1"
FT                   /product="transmembrane pair domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transmembrane pair domain-containing protein;
FT                   KEGG: dia:Dtpsy_0156 transmembrane pair domain protein"
FT                   /db_xref="GI:319760938"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="GeneID:10102225"
FT                   /protein_id="YP_004124875.1"
FT   sig_peptide     223917..224066
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.648 at
FT                   residue 50"
FT                   /locus_tag="Alide_0202"
FT   misc_feature    223944..224363
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG4125"
FT                   /db_xref="CDD:33882"
FT                   /locus_tag="Alide_0202"
FT   misc_feature    223947..224147
FT                   /note="Bacterial Transmembrane Pair family; Region: BTP;
FT                   pfam05232"
FT                   /db_xref="CDD:147435"
FT                   /locus_tag="Alide_0202"
FT   misc_feature    224151..224351
FT                   /note="Bacterial Transmembrane Pair family; Region: BTP;
FT                   pfam05232"
FT                   /db_xref="CDD:147435"
FT                   /locus_tag="Alide_0202"
FT   gene            224413..225349
FT                   /db_xref="GeneID:10102226"
FT                   /locus_tag="Alide_0203"
FT                   /pseudo
FT   gene            225477..228212
FT                   /db_xref="GeneID:10102227"
FT                   /locus_tag="Alide_0204"
FT   CDS_pept        225477..228212
FT                   /locus_tag="Alide_0204"
FT                   /gene_family="HOG000251409" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methionine synthase; KEGG: dac:Daci_0232
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="GI:319760939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008705"
FT                   /db_xref="GO:0031419"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="GeneID:10102227"
FT                   /product="methionine synthase"
FT                   /protein_id="YP_004124876.1"
FT   misc_feature    225486..228116
FT                   /note="Methionine synthase I, cobalamin-binding domain
FT                   [Amino acid transport and metabolism]; Region: MetH;
FT                   COG1410"
FT                   /db_xref="CDD:31600"
FT                   /locus_tag="Alide_0204"
FT   misc_feature    225549..226319
FT                   /note="MeTr subgroup of pterin binding enzymes. This family
FT                   includes cobalamin-dependent methyltransferases such as
FT                   methyltetrahydrofolate, corrinoid iron-sulfur protein
FT                   methyltransferase (MeTr) and methionine synthase (MetH).
FT                   Cobalamin-dependent...; Region: MeTr; cd00740"
FT                   /db_xref="CDD:29546"
FT                   /locus_tag="Alide_0204"
FT   misc_feature    order(225573..225575,225783..225785,225846..225848,
FT                   225852..225854,225930..225932,226047..226049,
FT                   226164..226166,226176..226178,226269..226271,
FT                   226275..226277)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29546"
FT                   /locus_tag="Alide_0204"
FT   misc_feature    226464..227150
FT                   /note="B12 binding domain of methionine synthase. This
FT                   domain binds methylcobalamin, which it uses as an
FT                   intermediate methyl carrier from methyltetrahydrofolate
FT                   (CH3H4folate) to homocysteine (Hcy); Region:
FT                   methionine_synthase_B12_BD; cd02069"
FT                   /db_xref="CDD:30207"
FT                   /locus_tag="Alide_0204"
FT   misc_feature    order(226584..226586,226596..226598,226647..226649,
FT                   226656..226658,226791..226811,226818..226820,
FT                   226929..226937,226941..226949,227040..227042,
FT                   227106..227108,227115..227117,227124..227126)
FT                   /note="B12 binding site; other site"
FT                   /db_xref="CDD:30207"
FT                   /locus_tag="Alide_0204"
FT   misc_feature    226800..226802
FT                   /note="cobalt ligand; other site"
FT                   /db_xref="CDD:30207"
FT                   /locus_tag="Alide_0204"
FT   misc_feature    227706..228116
FT                   /note="Vitamin B12 dependent methionine synthase,
FT                   activation domain; Region: Met_synt_B12; pfam02965"
FT                   /db_xref="CDD:111813"
FT                   /locus_tag="Alide_0204"
FT   gene            228371..231460
FT                   /db_xref="GeneID:10102228"
FT                   /locus_tag="Alide_0205"
FT   CDS_pept        228371..231460
FT                   /locus_tag="Alide_0205"
FT                   /gene_family="HOG000229926" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01865"
FT                   /codon_start="1"
FT                   /product="crispr-associated protein, csn1 family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csn1 family;
FT                   KEGG: vei:Veis_1230 CRISPR-associated endonuclease Csn1
FT                   family protein"
FT                   /db_xref="GI:319760940"
FT                   /db_xref="InterPro:IPR010145"
FT                   /db_xref="GeneID:10102228"
FT                   /protein_id="YP_004124877.1"
FT   misc_feature    228386..230716
FT                   /note="CRISPR-associated protein, Csn1 family; Region:
FT                   cas_Csn1; TIGR01865"
FT                   /db_xref="CDD:162567"
FT                   /locus_tag="Alide_0205"
FT   gene            231466..232395
FT                   /db_xref="GeneID:10102229"
FT                   /locus_tag="Alide_0206"
FT   CDS_pept        231466..232395
FT                   /locus_tag="Alide_0206"
FT                   /gene_family="HOG000022412" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03639"
FT                   /codon_start="1"
FT                   /product="crispr-associated protein cas1"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_1231 CRISPR-associated Cas1 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48"
FT                   /db_xref="GI:319760941"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="GeneID:10102229"
FT                   /protein_id="YP_004124878.1"
FT   misc_feature    231475..232305
FT                   /note="CRISPR associated protein Cas1; Region: Cas_Cas1;
FT                   cl00656"
FT                   /db_xref="CDD:163892"
FT                   /locus_tag="Alide_0206"
FT   gene            232438..232743
FT                   /db_xref="GeneID:10102230"
FT                   /locus_tag="Alide_0207"
FT   CDS_pept        232438..232743
FT                   /locus_tag="Alide_0207"
FT                   /gene_family="HOG000022401" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /codon_start="1"
FT                   /product="crispr-associated protein cas2"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_1232 CRISPR-associated Cas2 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   Virulence-associated protein D / CRISPR associated protein
FT                   Cas2"
FT                   /db_xref="GI:319760942"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="GeneID:10102230"
FT                   /protein_id="YP_004124879.1"
FT   misc_feature    232438..232740
FT                   /note="CRISPR associated protein Cas2; Region: CRISPR_Cas2;
FT                   cl11442"
FT                   /db_xref="CDD:164225"
FT                   /locus_tag="Alide_0207"
FT   gene            complement(233453..233696)
FT                   /db_xref="GeneID:10102231"
FT                   /locus_tag="Alide_0208"
FT                   /pseudo
FT   gene            complement(233693..234955)
FT                   /db_xref="GeneID:10102232"
FT                   /locus_tag="Alide_0209"
FT   CDS_pept        complement(233693..234955)
FT                   /locus_tag="Alide_0209"
FT                   /gene_family="HOG000289491" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03743"
FT                   /codon_start="1"
FT                   /product="conjugation trbi family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   ajs:Ajs_2902 conjugation TrbI family protein"
FT                   /db_xref="GI:319760943"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="GeneID:10102232"
FT                   /protein_id="YP_004124880.1"
FT   misc_feature    complement(233738..234286)
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="Alide_0209"
FT   gene            complement(234957..235937)
FT                   /db_xref="GeneID:10102233"
FT                   /locus_tag="Alide_0210"
FT   CDS_pept        complement(234957..235937)
FT                   /locus_tag="Alide_0210"
FT                   /gene_family="HOG000289480" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02775"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbg"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2903 conjugal transfer protein
FT                   TrbG/VirB9/CagX; TIGRFAM: P-type conjugative transfer
FT                   protein TrbG; PFAM: Conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="GI:319760944"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="GeneID:10102233"
FT                   /protein_id="YP_004124881.1"
FT   sig_peptide     complement(235863..235937)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.799 at
FT                   residue 25"
FT                   /locus_tag="Alide_0210"
FT   misc_feature    complement(234975..235250)
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cd06911"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Alide_0210"
FT   misc_feature    complement(order(234984..235004,235026..235028,
FT                   235185..235202,235218..235238))
FT                   /note="VirB7 interaction site; other site"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Alide_0210"
FT   gene            complement(235934..236638)
FT                   /db_xref="GeneID:10102234"
FT                   /locus_tag="Alide_0211"
FT   CDS_pept        complement(235934..236638)
FT                   /locus_tag="Alide_0211"
FT                   /gene_family="HOG000289469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rpic_2651"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein trbf"
FT                   /transl_table="11"
FT                   /note="KEGG: rpi:Rpic_2651 conjugal transfer protein TrbF"
FT                   /db_xref="GI:319760945"
FT                   /db_xref="GeneID:10102234"
FT                   SRELEGNEGAKP"
FT                   /protein_id="YP_004124882.1"
FT   misc_feature    complement(235958..236638)
FT                   /note="VirB8 protein; Region: VirB8; cl01500"
FT                   /db_xref="CDD:186438"
FT                   /locus_tag="Alide_0211"
FT   gene            complement(236657..237991)
FT                   /db_xref="GeneID:10102235"
FT                   /locus_tag="Alide_0212"
FT   CDS_pept        complement(236657..237991)
FT                   /locus_tag="Alide_0212"
FT                   /gene_family="HOG000289458" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02783"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbl"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2905 conjugal transfer protein TrbL;
FT                   TIGRFAM: P-type conjugative transfer protein TrbL; PFAM:
FT                   TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="GI:319760946"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="GeneID:10102235"
FT                   /protein_id="YP_004124883.1"
FT   misc_feature    complement(<237176..237991)
FT                   /note="TrbL/VirB6 plasmid conjugal transfer protein;
FT                   Region: TrbL; cl01503"
FT                   /db_xref="CDD:174636"
FT                   /locus_tag="Alide_0212"
FT   misc_feature    complement(236663..>236932)
FT                   /note="conjugal transfer protein TrbL; Provisional; Region:
FT                   PRK13875"
FT                   /db_xref="CDD:184359"
FT                   /locus_tag="Alide_0212"
FT   gene            complement(238004..238729)
FT                   /db_xref="GeneID:10102236"
FT                   /locus_tag="Alide_0213"
FT   CDS_pept        complement(238004..238729)
FT                   /locus_tag="Alide_0213"
FT                   /gene_family="HOG000289447" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02780"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbj"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbJ;
FT                   KEGG: ajs:Ajs_2907 conjugal transfer protein TrbJ"
FT                   /db_xref="GI:319760947"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="GeneID:10102236"
FT                   /protein_id="YP_004124884.1"
FT   sig_peptide     complement(238664..238729)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT                   /locus_tag="Alide_0213"
FT   misc_feature    complement(238049..238666)
FT                   /note="Conjugal transfer/entry exclusion protein
FT                   [Intracellular trafficking and secretion]; Region: COG5314;
FT                   cl02193"
FT                   /db_xref="CDD:186517"
FT                   /locus_tag="Alide_0213"
FT   gene            complement(238726..241161)
FT                   /db_xref="GeneID:10102237"
FT                   /locus_tag="Alide_0214"
FT   CDS_pept        complement(238726..241161)
FT                   /locus_tag="Alide_0214"
FT                   /gene_family="HOG000289436" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03135"
FT                   /codon_start="1"
FT                   /product="cage, trbe, virb component of type iv transporter
FT                   system, conserved region protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2908 conjugal transfer ATPase TrbE;
FT                   PFAM: CagE, TrbE, VirB component of type IV transporter
FT                   system, conserved region; SMART: AAA ATPase"
FT                   /db_xref="GI:319760948"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="GeneID:10102237"
FT                   /protein_id="YP_004124885.1"
FT   misc_feature    complement(238729..241161)
FT                   /note="conjugal transfer ATPase TrbE; Provisional; Region:
FT                   PRK13873"
FT                   /db_xref="CDD:184357"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(239998..>240474)
FT                   /note="VirB family, component of type IV transporter
FT                   system; Region: CagE_TrbE_VirB; pfam03135"
FT                   /db_xref="CDD:111973"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(<239599..239835)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(order(239797..239805,239815..239820))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(order(239728..239733,239740..239742,
FT                   239797..239805,239815..239817))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(239119..>239262)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(239239..239256)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(239221..239232)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Alide_0214"
FT   misc_feature    complement(239134..239154)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Alide_0214"
FT   gene            complement(241171..241443)
FT                   /db_xref="GeneID:10102238"
FT                   /locus_tag="Alide_0215"
FT   CDS_pept        complement(241171..241443)
FT                   /locus_tag="Alide_0215"
FT                   /gene_family="HOG000289425" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2909"
FT                   /codon_start="1"
FT                   /product="conjugal transfer trbd transmembrane protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2909 conjugal transfer TrbD
FT                   transmembrane protein"
FT                   /db_xref="GI:319760949"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="GeneID:10102238"
FT                   /protein_id="YP_004124886.1"
FT   misc_feature    complement(241174..241443)
FT                   /note="Type IV secretory pathway, VirB3-like protein;
FT                   Region: VirB3; cl01501"
FT                   /db_xref="CDD:186439"
FT                   /locus_tag="Alide_0215"
FT   gene            complement(241440..241817)
FT                   /db_xref="GeneID:10102239"
FT                   /locus_tag="Alide_0216"
FT   CDS_pept        complement(241440..241817)
FT                   /locus_tag="Alide_0216"
FT                   /gene_family="HOG000289414" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04956"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein trbc"
FT                   /transl_table="11"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   dac:Daci_2698 conjugal transfer protein TrbC"
FT                   /db_xref="GI:319760950"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="GeneID:10102239"
FT                   /protein_id="YP_004124887.1"
FT   sig_peptide     complement(241677..241817)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.977 at
FT                   residue 47"
FT                   /locus_tag="Alide_0216"
FT   misc_feature    complement(<241518..>241691)
FT                   /note="TrbC/VIRB2 family; Region: TrbC; cl01583"
FT                   /db_xref="CDD:186454"
FT                   /locus_tag="Alide_0216"
FT   gene            complement(241814..242848)
FT                   /db_xref="GeneID:10102240"
FT                   /locus_tag="Alide_0217"
FT   CDS_pept        complement(241814..242848)
FT                   /locus_tag="Alide_0217"
FT                   /gene_family="HOG000119938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02782"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer atpase trbb"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2911 type II secretion system protein
FT                   E; TIGRFAM: P-type conjugative transfer ATPase TrbB; PFAM:
FT                   type II secretion system protein E"
FT                   /db_xref="GI:319760951"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="GeneID:10102240"
FT                   GELP"
FT                   /protein_id="YP_004124888.1"
FT   misc_feature    complement(241910..242797)
FT                   /note="P-type conjugative transfer ATPase TrbB; Region:
FT                   TrbB_P; TIGR02782"
FT                   /db_xref="CDD:163017"
FT                   /locus_tag="Alide_0217"
FT   misc_feature    complement(241946..242473)
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Alide_0217"
FT   misc_feature    complement(order(241967..241969,242354..242371,
FT                   242462..242464))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Alide_0217"
FT   misc_feature    complement(order(242357..242365,242375..242380))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Alide_0217"
FT   misc_feature    complement(order(242063..242065,242072..242074,
FT                   242084..242092,242120..242125,242132..242134,
FT                   242144..242146,242183..242185,242189..242197,
FT                   242246..242251,242255..242266,242285..242287,
FT                   242309..242311,242369..242374))
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Alide_0217"
FT   misc_feature    complement(242165..242182)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Alide_0217"
FT   gene            complement(242845..243291)
FT                   /db_xref="GeneID:10102241"
FT                   /locus_tag="Alide_0218"
FT   CDS_pept        complement(242845..243291)
FT                   /locus_tag="Alide_0218"
FT                   /gene_family="HOG000289403" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2912"
FT                   /codon_start="1"
FT                   /product="copg/DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2912 CopG/DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="GI:319760952"
FT                   /db_xref="GeneID:10102241"
FT                   /protein_id="YP_004124889.1"
FT   gene            complement(243288..245291)
FT                   /db_xref="GeneID:10102242"
FT                   /locus_tag="Alide_0219"
FT   CDS_pept        complement(243288..245291)
FT                   /locus_tag="Alide_0219"
FT                   /gene_family="HOG000289392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /codon_start="1"
FT                   /product="trag family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TRAG family protein; KEGG: dac:Daci_2701
FT                   conjugal transfer coupling protein TraG"
FT                   /db_xref="GI:319760953"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="GeneID:10102242"
FT                   /protein_id="YP_004124890.1"
FT   misc_feature    complement(243564..245222)
FT                   /note="Type IV secretory pathway, VirD4 components
FT                   [Intracellular trafficking and secretion]; Region: VirD4;
FT                   COG3505"
FT                   /db_xref="CDD:33308"
FT                   /locus_tag="Alide_0219"
FT   misc_feature    complement(243720..244853)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Alide_0219"
FT   misc_feature    complement(order(244815..244823,244833..244838))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Alide_0219"
FT   misc_feature    complement(order(244059..244064,244755..244760,
FT                   244764..244766,244815..244823,244833..244835))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Alide_0219"
FT   misc_feature    complement(244062..244076)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Alide_0219"
FT   gene            complement(245507..245779)
FT                   /db_xref="GeneID:10102243"
FT                   /locus_tag="Alide_0220"
FT   CDS_pept        complement(245507..245779)
FT                   /locus_tag="Alide_0220"
FT                   /gene_family="HOG000289371" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00894"
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmj:BMULJ_00894 probable lipoprotein"
FT                   /db_xref="GI:319760954"
FT                   /db_xref="GeneID:10102243"
FT                   /protein_id="YP_004124891.1"
FT   sig_peptide     complement(245717..245779)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.778 at
FT                   residue 21"
FT                   /locus_tag="Alide_0220"
FT   gene            complement(245815..246708)
FT                   /db_xref="GeneID:10102244"
FT                   /locus_tag="Alide_0221"
FT   CDS_pept        complement(245815..246708)
FT                   /locus_tag="Alide_0221"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sml:Smlt1302 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760955"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102244"
FT                   LARFIERVEALGPGDA"
FT                   /protein_id="YP_004124892.1"
FT   misc_feature    complement(245848..246702)
FT                   /note="DNA-binding transcriptional activator XapR;
FT                   Provisional; Region: PRK09986"
FT                   /db_xref="CDD:182183"
FT                   /locus_tag="Alide_0221"
FT   misc_feature    complement(246523..246702)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0221"
FT   misc_feature    complement(245842..246435)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators involved in the catabolism of
FT                   aromatic compounds and that of other related regulators,
FT                   contains type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_aromatics_like; cd08414"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Alide_0221"
FT   misc_feature    complement(order(245947..245949,246004..246009,
FT                   246013..246018,246034..246039,246094..246099,
FT                   246199..246201,246331..246333,246337..246339,
FT                   246343..246345,246367..246369,246376..246381,
FT                   246385..246390,246397..246399,246418..246420))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Alide_0221"
FT   misc_feature    complement(order(246103..246105,246124..246129,
FT                   246268..246270,246415..246417))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Alide_0221"
FT   gene            complement(246778..249966)
FT                   /db_xref="GeneID:10102245"
FT                   /locus_tag="Alide_0222"
FT   CDS_pept        complement(246778..249966)
FT                   /locus_tag="Alide_0222"
FT                   /gene_family="HOG000126203" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump, czca family"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_1849 CzcA family heavy metal efflux
FT                   protein; TIGRFAM: heavy metal efflux pump, CzcA family;
FT                   PFAM: acriflavin resistance protein"
FT                   /db_xref="GI:319760956"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:10102245"
FT                   EDVTAEPAHEGVTA"
FT                   /protein_id="YP_004124893.1"
FT   misc_feature    complement(246799..249966)
FT                   /note="heavy metal efflux pump (cobalt-zinc-cadmium);
FT                   Region: 2A0601; TIGR00914"
FT                   /db_xref="CDD:129992"
FT                   /locus_tag="Alide_0222"
FT   gene            complement(249983..251575)
FT                   /db_xref="GeneID:10102246"
FT                   /locus_tag="Alide_0223"
FT   CDS_pept        complement(249983..251575)
FT                   /locus_tag="Alide_0223"
FT                   /gene_family="HOG000144730" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, rnd family, mfp subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_1848 RND family efflux transporter MFP
FT                   subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="GI:319760957"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:10102246"
FT                   KSELGKASAEHTH"
FT                   /protein_id="YP_004124894.1"
FT   misc_feature    complement(250022..250831)
FT                   /note="Membrane Fusion Protein cluster 2 (function with RND
FT                   porters); Region: 8a0102; TIGR00999"
FT                   /db_xref="CDD:162153"
FT                   /locus_tag="Alide_0223"
FT   gene            complement(251578..252903)
FT                   /db_xref="GeneID:10102247"
FT                   /locus_tag="Alide_0224"
FT   CDS_pept        complement(251578..252903)
FT                   /locus_tag="Alide_0224"
FT                   /gene_family="HOG000144619" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   ajs:Ajs_1847 outer membrane efflux protein"
FT                   /db_xref="GI:319760958"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:10102247"
FT                   /protein_id="YP_004124895.1"
FT   sig_peptide     complement(252817..252903)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.927 at
FT                   residue 29"
FT                   /locus_tag="Alide_0224"
FT   misc_feature    complement(251671..252873)
FT                   /note="Outer membrane protein [Cell envelope biogenesis,
FT                   outer membrane / Intracellular trafficking and secretion];
FT                   Region: TolC; COG1538"
FT                   /db_xref="CDD:31727"
FT                   /locus_tag="Alide_0224"
FT   misc_feature    complement(252217..252741)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Alide_0224"
FT   misc_feature    complement(251671..252150)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Alide_0224"
FT   gene            complement(253070..253423)
FT                   /db_xref="GeneID:10102248"
FT                   /locus_tag="Alide_0225"
FT   CDS_pept        complement(253070..253423)
FT                   /locus_tag="Alide_0225"
FT                   /gene_family="HOG000229574" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daro_2621"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: dar:Daro_2621 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760959"
FT                   /db_xref="InterPro:IPR020487"
FT                   /db_xref="GeneID:10102248"
FT                   PERLERPRWRALA"
FT                   /protein_id="YP_004124896.1"
FT   sig_peptide     complement(253361..253423)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 21"
FT                   /locus_tag="Alide_0225"
FT   gene            complement(253630..253965)
FT                   /db_xref="GeneID:10102249"
FT                   /locus_tag="Alide_0226"
FT   CDS_pept        complement(253630..253965)
FT                   /locus_tag="Alide_0226"
FT                   /gene_family="HOG000229681" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2700"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2700 hypothetical protein"
FT                   /db_xref="GI:319760960"
FT                   /db_xref="GeneID:10102249"
FT                   LEMYSGG"
FT                   /protein_id="YP_004124897.1"
FT   sig_peptide     complement(253891..253965)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT                   /locus_tag="Alide_0226"
FT   gene            254110..254796
FT                   /db_xref="GeneID:10102250"
FT                   /locus_tag="Alide_0227"
FT   CDS_pept        254110..254796
FT                   /locus_tag="Alide_0227"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01387"
FT                   /codon_start="1"
FT                   /product="heavy metal response regulator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein; KEGG: dia:Dtpsy_2215 two
FT                   component heavy metal response transcriptional regulator,
FT                   winged helix family; SMART: response regulator receiver"
FT                   /db_xref="GI:319760961"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="GeneID:10102250"
FT                   LEDRQS"
FT                   /protein_id="YP_004124898.1"
FT   misc_feature    254116..254778
FT                   /note="heavy metal response regulator; Region:
FT                   cztR_silR_copR; TIGR01387"
FT                   /db_xref="CDD:130454"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    254119..254454
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    order(254128..254133,254260..254262,254284..254286,
FT                   254341..254343,254398..254400,254407..254412)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    254260..254262
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    order(254269..254274,254278..254286)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    254407..254415
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    254497..254778
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Alide_0227"
FT   misc_feature    order(254569..254571,254626..254631,254683..254685,
FT                   254692..254694,254716..254721,254752..254754,
FT                   254767..254769)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Alide_0227"
FT   gene            254925..256115
FT                   /db_xref="GeneID:10102251"
FT                   /locus_tag="Alide_0228"
FT   CDS_pept        254925..256115
FT                   /locus_tag="Alide_0228"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01386"
FT                   /codon_start="1"
FT                   /product="heavy metal sensor kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; KEGG: dia:Dtpsy_2216 heavy metal sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="GI:319760962"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0004673"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="GeneID:10102251"
FT                   /protein_id="YP_004124899.1"
FT   misc_feature    254928..256097
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    255441..255632
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    order(255456..255458,255468..255470,255480..255482,
FT                   255489..255491,255501..255503,255510..255512,
FT                   255561..255563,255573..255575,255582..255584,
FT                   255594..255596,255603..255605,255615..255617)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    255474..255476
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    255786..256070
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    order(255804..255806,255816..255818,255825..255827,
FT                   255894..255896,255900..255902,255906..255908,
FT                   255912..255917,255996..256007,256053..256055,
FT                   256059..256061)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    255816..255818
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0228"
FT   misc_feature    order(255906..255908,255912..255914,255996..255998,
FT                   256002..256004)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0228"
FT   gene            complement(256151..256843)
FT                   /db_xref="GeneID:10102252"
FT                   /locus_tag="Alide_0229"
FT   CDS_pept        complement(256151..256843)
FT                   /locus_tag="Alide_0229"
FT                   /gene_family="HOG000098334" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Arad_2530"
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: ara:Arad_2530 transporter"
FT                   /db_xref="GI:319760963"
FT                   /db_xref="GeneID:10102252"
FT                   LLLEEVIG"
FT                   /protein_id="YP_004124900.1"
FT   sig_peptide     complement(256772..256843)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.685 at
FT                   residue 24"
FT                   /locus_tag="Alide_0229"
FT   gene            complement(256847..257137)
FT                   /db_xref="GeneID:10102253"
FT                   /locus_tag="Alide_0230"
FT   CDS_pept        complement(256847..257137)
FT                   /locus_tag="Alide_0230"
FT                   /gene_family="HOG000011608" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sfri_3475"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: sfr:Sfri_3475 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760964"
FT                   /db_xref="GeneID:10102253"
FT                   /protein_id="YP_004124901.1"
FT   misc_feature    complement(<256850..257002)
FT                   /note="putative protein serine/threonine phosphatase;
FT                   Provisional; Region: PRK14559"
FT                   /db_xref="CDD:184743"
FT                   /locus_tag="Alide_0230"
FT   gene            complement(257160..259469)
FT                   /db_xref="GeneID:10102254"
FT                   /locus_tag="Alide_0231"
FT   CDS_pept        complement(257160..259469)
FT                   /locus_tag="Alide_0231"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /codon_start="1"
FT                   /product="heavy metal translocating p-type atpase"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_3562 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:319760965"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR001366"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006404"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:10102254"
FT                   LVVFNGLRLLRQRAGQ"
FT                   /protein_id="YP_004124902.1"
FT   misc_feature    complement(259302..259469)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Alide_0231"
FT   misc_feature    complement(order(259452..259454,259461..259469))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Alide_0231"
FT   misc_feature    complement(257166..259289)
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="Alide_0231"
FT   misc_feature    complement(259098..259277)
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cl00207"
FT                   /db_xref="CDD:163733"
FT                   /locus_tag="Alide_0231"
FT   misc_feature    complement(258108..258776)
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Alide_0231"
FT   misc_feature    complement(257382..257729)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:187016"
FT                   /locus_tag="Alide_0231"
FT   gene            259708..260163
FT                   /db_xref="GeneID:10102255"
FT                   /locus_tag="Alide_0232"
FT   CDS_pept        259708..260163
FT                   /locus_tag="Alide_0232"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /codon_start="1"
FT                   /product="cd(ii)/pb(ii)-responsive transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="SMART: regulatory protein MerR; manually curated;
FT                   TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; KEGG: mpt:Mpe_A1657 transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR"
FT                   /db_xref="GI:319760966"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="GeneID:10102255"
FT                   /protein_id="YP_004124903.1"
FT   misc_feature    259708..260088
FT                   /note="Cd(II)/Pb(II)-responsive transcriptional regulator;
FT                   Region: CadR-PbrR; TIGR02047"
FT                   /db_xref="CDD:131102"
FT                   /locus_tag="Alide_0232"
FT   misc_feature    259708..260088
FT                   /note="Helix-Turn-Helix DNA binding domain of the CadR and
FT                   PbrR transcription regulators; Region: HTH_CadR-PbrR;
FT                   cd04784"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="Alide_0232"
FT   misc_feature    order(259711..259719,259759..259761,259810..259818)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="Alide_0232"
FT   misc_feature    order(259852..259854,259861..259863,259873..259878,
FT                   259903..259905,259936..259941,259948..259950,
FT                   259957..259959,259969..259971,259987..259989,
FT                   259999..260001,260008..260013,260032..260034,
FT                   260047..260052,260068..260070,260074..260076)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="Alide_0232"
FT   misc_feature    order(259936..259938,260041..260043,260068..260070)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:133411"
FT                   /locus_tag="Alide_0232"
FT   gene            complement(260164..262146)
FT                   /db_xref="GeneID:10102256"
FT                   /locus_tag="Alide_0233"
FT   CDS_pept        complement(260164..262146)
FT                   /locus_tag="Alide_0233"
FT                   /gene_family="HOG000289348" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0453"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0453 hypothetical protein"
FT                   /db_xref="GI:319760967"
FT                   /db_xref="GeneID:10102256"
FT                   /protein_id="YP_004124904.1"
FT   misc_feature    complement(260992..261930)
FT                   /note="Relaxase/Mobilisation nuclease domain; Region:
FT                   Relaxase; cl01584"
FT                   /db_xref="CDD:174650"
FT                   /locus_tag="Alide_0233"
FT   misc_feature    complement(260170..261255)
FT                   /note="Protein of unknown function (DUF3363); Region:
FT                   DUF3363; pfam11843"
FT                   /db_xref="CDD:152279"
FT                   /locus_tag="Alide_0233"
FT   gene            complement(262143..262598)
FT                   /db_xref="GeneID:10102257"
FT                   /locus_tag="Alide_0234"
FT   CDS_pept        complement(262143..262598)
FT                   /locus_tag="Alide_0234"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Smlt1309"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: sml:Smlt1309 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760968"
FT                   /db_xref="GeneID:10102257"
FT                   /protein_id="YP_004124905.1"
FT   gene            complement(262595..263194)
FT                   /db_xref="GeneID:10102258"
FT                   /locus_tag="Alide_0235"
FT   CDS_pept        complement(262595..263194)
FT                   /locus_tag="Alide_0235"
FT                   /gene_family="HOG000289337" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10502"
FT                   /codon_start="1"
FT                   /product="peptidase s26, conserved region protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S26, conserved region; KEGG:
FT                   dia:Dtpsy_1292 TraF peptidase. Serine peptidase. MEROPS
FT                   family S26C"
FT                   /db_xref="GI:319760969"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="GeneID:10102258"
FT                   /protein_id="YP_004124906.1"
FT   misc_feature    complement(262610..263047)
FT                   /note="Peptidase S26; Region: Peptidase_S26; pfam10502"
FT                   /db_xref="CDD:151062"
FT                   /locus_tag="Alide_0235"
FT   misc_feature    complement(262616..263038)
FT                   /note="The S24, S26 LexA/signal peptidase superfamily
FT                   contains LexA-related and type I signal peptidase families.
FT                   The S24 LexA protein domains include: the lambda repressor
FT                   CI/C2 family and related bacterial prophage repressor
FT                   proteins; LexA (EC; Region:
FT                   Peptidase_S24_S26; cl10465"
FT                   /db_xref="CDD:186999"
FT                   /locus_tag="Alide_0235"
FT   gene            complement(263191..263736)
FT                   /db_xref="GeneID:10102259"
FT                   /locus_tag="Alide_0236"
FT   CDS_pept        complement(263191..263736)
FT                   /locus_tag="Alide_0236"
FT                   /gene_family="HOG000289326" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3522"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3522 hypothetical protein"
FT                   /db_xref="GI:319760970"
FT                   /db_xref="GeneID:10102259"
FT                   PEYTAERHAAWLTGRALS"
FT                   /protein_id="YP_004124907.1"
FT   sig_peptide     complement(263671..263736)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT                   /locus_tag="Alide_0236"
FT   misc_feature    complement(263197..263643)
FT                   /note="Protein of unknown function (DUF2840); Region:
FT                   DUF2840; pfam11000"
FT                   /db_xref="CDD:151447"
FT                   /locus_tag="Alide_0236"
FT   gene            complement(263733..264017)
FT                   /db_xref="GeneID:10102260"
FT                   /locus_tag="Alide_0237"
FT   CDS_pept        complement(263733..264017)
FT                   /locus_tag="Alide_0237"
FT                   /gene_family="HOG000289305" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_0688"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0688 hypothetical protein"
FT                   /db_xref="GI:319760971"
FT                   /db_xref="GeneID:10102260"
FT                   /protein_id="YP_004124908.1"
FT   gene            complement(264014..264652)
FT                   /db_xref="GeneID:10102261"
FT                   /locus_tag="Alide_0238"
FT   CDS_pept        complement(264014..264652)
FT                   /locus_tag="Alide_0238"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1879"
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: tgr:Tgr7_1879 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="GI:319760972"
FT                   /db_xref="GeneID:10102261"
FT                   /protein_id="YP_004124909.1"
FT   misc_feature    complement(264026..264652)
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="Alide_0238"
FT   misc_feature    complement(264224..264649)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0238"
FT   misc_feature    complement(264608..264628)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0238"
FT   misc_feature    complement(order(264395..264397,264608..264610))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Alide_0238"
FT   gene            complement(264906..265739)
FT                   /db_xref="GeneID:10102262"
FT                   /locus_tag="Alide_0239"
FT   CDS_pept        complement(264906..265739)
FT                   /locus_tag="Alide_0239"
FT                   /gene_family="HOG000289304" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10134"
FT                   /codon_start="1"
FT                   /product="replication initiator protein a"
FT                   /transl_table="11"
FT                   /note="PFAM: Replication initiator protein A; KEGG:
FT                   dac:Daci_2721 replication initiator and transcription
FT                   repressor protein"
FT                   /db_xref="GI:319760973"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="GeneID:10102262"
FT                   /protein_id="YP_004124910.1"
FT   misc_feature    complement(264981..265670)
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="Alide_0239"
FT   gene            complement(265766..266047)
FT                   /db_xref="GeneID:10102263"
FT                   /locus_tag="Alide_0240"
FT   CDS_pept        complement(265766..266047)
FT                   /locus_tag="Alide_0240"
FT                   /gene_family="HOG000289292" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2652"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2652 hypothetical protein"
FT                   /db_xref="GI:319760974"
FT                   /db_xref="GeneID:10102263"
FT                   /protein_id="YP_004124911.1"
FT   gene            complement(266131..266904)
FT                   /db_xref="GeneID:10102264"
FT                   /locus_tag="Alide_0241"
FT   CDS_pept        complement(266131..266904)
FT                   /locus_tag="Alide_0241"
FT                   /gene_family="HOG000289271" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2651"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2651 hypothetical protein"
FT                   /db_xref="GI:319760975"
FT                   /db_xref="GeneID:10102264"
FT                   /protein_id="YP_004124912.1"
FT   misc_feature    complement(266182..>266370)
FT                   /note="Uncharacterized conserved protein (DUF2285); Region:
FT                   DUF2285; cl02246"
FT                   /db_xref="CDD:154817"
FT                   /locus_tag="Alide_0241"
FT   gene            complement(267233..267583)
FT                   /db_xref="GeneID:10102265"
FT                   /locus_tag="Alide_0242"
FT   CDS_pept        complement(267233..267583)
FT                   /locus_tag="Alide_0242"
FT                   /gene_family="HOG000289270" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3529"
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3529 lipoprotein"
FT                   /db_xref="GI:319760976"
FT                   /db_xref="GeneID:10102265"
FT                   LRLAQENGSIVD"
FT                   /protein_id="YP_004124913.1"
FT   misc_feature    complement(267236..267571)
FT                   /note="Protein of unknown function (DUF2958); Region:
FT                   DUF2958; pfam11171"
FT                   /db_xref="CDD:151613"
FT                   /locus_tag="Alide_0242"
FT   gene            267842..268135
FT                   /db_xref="GeneID:10102266"
FT                   /locus_tag="Alide_0243"
FT   CDS_pept        267842..268135
FT                   /locus_tag="Alide_0243"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3530 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="GI:319760977"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:10102266"
FT                   /protein_id="YP_004124914.1"
FT   misc_feature    267917..268078
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0243"
FT   misc_feature    order(267929..267931,267941..267943,268016..268018)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0243"
FT   misc_feature    order(267938..267940,268013..268015)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0243"
FT   misc_feature    order(267959..267964,267995..267997,268004..268006,
FT                   268016..268021)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0243"
FT   gene            complement(268520..268834)
FT                   /db_xref="GeneID:10102267"
FT                   /locus_tag="Alide_0244"
FT   CDS_pept        complement(268520..268834)
FT                   /locus_tag="Alide_0244"
FT                   /gene_family="HOG000140892" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05284"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   aav:Aave_0681 hypothetical protein"
FT                   /db_xref="GI:319760978"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="GeneID:10102267"
FT                   "
FT                   /protein_id="YP_004124915.1"
FT   misc_feature    complement(268526..268834)
FT                   /note="Protein of unknown function (DUF736); Region:
FT                   DUF736; cl02303"
FT                   /db_xref="CDD:154848"
FT                   /locus_tag="Alide_0244"
FT   gene            269905..270819
FT                   /db_xref="GeneID:10102268"
FT                   /locus_tag="Alide_0245"
FT   CDS_pept        269905..270819
FT                   /locus_tag="Alide_0245"
FT                   /gene_family="HOG000219404" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RPC_3544"
FT                   /codon_start="1"
FT                   /product="phage associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpc:RPC_3544 phage associated protein"
FT                   /db_xref="GI:319760979"
FT                   /db_xref="GeneID:10102268"
FT                   /protein_id="YP_004124916.1"
FT   gene            270960..271802
FT                   /db_xref="GeneID:10102269"
FT                   /locus_tag="Alide_0246"
FT   CDS_pept        270960..271802
FT                   /locus_tag="Alide_0246"
FT                   /gene_family="HOG000219405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /codon_start="1"
FT                   /product="rela/spot domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: rpc:RPC_3545
FT                   RelA/SpoT"
FT                   /db_xref="GI:319760980"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="GeneID:10102269"
FT                   /protein_id="YP_004124917.1"
FT   misc_feature    270969..271328
FT                   /note="Nucleotidyltransferase (NT) domain of RelA- and
FT                   SpoT-like ppGpp synthetases and hydrolases; Region:
FT                   NT_Rel-Spo_like; cd05399"
FT                   /db_xref="CDD:143389"
FT                   /locus_tag="Alide_0246"
FT   misc_feature    order(270969..270971,270975..270977,271050..271055,
FT                   271065..271067,271158..271160,271164..271166,
FT                   271191..271193,271197..271199,271203..271205,
FT                   271215..271217,271284..271286,271290..271292,
FT                   271296..271298,271320..271325)
FT                   /note="synthetase active site; other site"
FT                   /db_xref="CDD:143389"
FT                   /locus_tag="Alide_0246"
FT   misc_feature    order(270969..270971,271158..271160,271164..271166,
FT                   271191..271193,271197..271199,271203..271205,
FT                   271215..271217,271284..271286,271290..271292,
FT                   271320..271322)
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143389"
FT                   /locus_tag="Alide_0246"
FT   misc_feature    order(271050..271052,271284..271286)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143389"
FT                   /locus_tag="Alide_0246"
FT   gene            complement(271936..272145)
FT                   /db_xref="GeneID:10102270"
FT                   /locus_tag="Alide_0247"
FT   CDS_pept        complement(271936..272145)
FT                   /locus_tag="Alide_0247"
FT                   /gene_family="HOG000229715" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_2732"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_2732 hypothetical protein"
FT                   /db_xref="GI:319760981"
FT                   /db_xref="GeneID:10102270"
FT                   /protein_id="YP_004124918.1"
FT   gene            complement(272208..274262)
FT                   /db_xref="GeneID:10102271"
FT                   /locus_tag="Alide_0248"
FT   CDS_pept        complement(272208..274262)
FT                   /locus_tag="Alide_0248"
FT                   /gene_family="HOG000222687" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="parb domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3534 ParB domain protein nuclease;
FT                   PFAM: ParB domain protein nuclease; SMART: ParB domain
FT                   protein nuclease"
FT                   /db_xref="GI:319760982"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:10102271"
FT                   /protein_id="YP_004124919.1"
FT   misc_feature    complement(<274011..274169)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Alide_0248"
FT   misc_feature    complement(<273735..274097)
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="Alide_0248"
FT   gene            complement(274328..275155)
FT                   /db_xref="GeneID:10102272"
FT                   /locus_tag="Alide_0249"
FT   CDS_pept        complement(274328..275155)
FT                   /locus_tag="Alide_0249"
FT                   /gene_family="HOG000222632" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2944"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2944 hypothetical protein"
FT                   /db_xref="GI:319760983"
FT                   /db_xref="GeneID:10102272"
FT                   /protein_id="YP_004124920.1"
FT   misc_feature    complement(274364..275047)
FT                   /note="Domain of unknown function (DUF932); Region: DUF932;
FT                   cl12129"
FT                   /db_xref="CDD:164334"
FT                   /locus_tag="Alide_0249"
FT   gene            276176..276409
FT                   /db_xref="GeneID:10102273"
FT                   /locus_tag="Alide_0250"
FT   CDS_pept        276176..276409
FT                   /locus_tag="Alide_0250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Hsero_2905"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hse:Hsero_2905 hypothetical protein"
FT                   /db_xref="GI:319760984"
FT                   /db_xref="GeneID:10102273"
FT                   /protein_id="YP_004124921.1"
FT   gene            276459..276767
FT                   /db_xref="GeneID:10102274"
FT                   /locus_tag="Alide_0251"
FT   CDS_pept        276459..276767
FT                   /locus_tag="Alide_0251"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain protein"
FT                   /transl_table="11"
FT                   /note="manually curated; PFAM: helix-turn-helix domain
FT                   protein; KEGG: hse:Hsero_2904 XRE family transcription
FT                   regulator protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:319760985"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:10102274"
FT                   /protein_id="YP_004124922.1"
FT   misc_feature    276468..276641
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0251"
FT   misc_feature    order(276480..276482,276492..276494,276567..276569)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0251"
FT   misc_feature    order(276489..276491,276564..276566)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0251"
FT   misc_feature    order(276510..276515,276546..276548,276555..276557,
FT                   276567..276572)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Alide_0251"
FT   gene            276730..277758
FT                   /db_xref="GeneID:10102275"
FT                   /locus_tag="Alide_0252"
FT   CDS_pept        276730..277758
FT                   /locus_tag="Alide_0252"
FT                   /gene_family="HOG000050991" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1473"
FT                   /codon_start="1"
FT                   /product="retron reverse transcriptase"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1473 retron reverse transcriptase"
FT                   /db_xref="GI:319760986"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="GeneID:10102275"
FT                   WE"
FT                   /protein_id="YP_004124923.1"
FT   misc_feature    276871..277512
FT                   /note="RT_Bac_retron_II: Reverse transcriptases (RTs) in
FT                   bacterial retrotransposons or retrons. The polymerase
FT                   reaction of this enzyme leads to the production of a unique
FT                   RNA-DNA complex called msDNA (multicopy single-stranded
FT                   (ss)DNA) in which a small ssDNA...; Region:
FT                   RT_Bac_retron_II; cd03487"
FT                   /db_xref="CDD:73160"
FT                   /locus_tag="Alide_0252"
FT   misc_feature    order(277057..277074,277186..277191,277288..277290,
FT                   277294..277299,277444..277449)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73160"
FT                   /locus_tag="Alide_0252"
FT   misc_feature    order(277057..277074,277186..277188,277294..277296)
FT                   /note="putative NTP binding site; other site"
FT                   /db_xref="CDD:73160"
FT                   /locus_tag="Alide_0252"
FT   misc_feature    277189..277191
FT                   /note="putative nucleic acid binding site; other site"
FT                   /db_xref="CDD:73160"
FT                   /locus_tag="Alide_0252"
FT   gene            complement(277930..278247)
FT                   /db_xref="GeneID:10102276"
FT                   /locus_tag="Alide_0253"
FT   CDS_pept        complement(277930..278247)
FT                   /locus_tag="Alide_0253"
FT                   /gene_family="HOG000139267" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2957"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2957 transcriptional regulator"
FT                   /db_xref="GI:319760987"
FT                   /db_xref="GeneID:10102276"
FT                   A"
FT                   /protein_id="YP_004124924.1"
FT   misc_feature    complement(277963..278247)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Alide_0253"
FT   gene            complement(278244..278573)
FT                   /db_xref="GeneID:10102277"
FT                   /locus_tag="Alide_0254"
FT   CDS_pept        complement(278244..278573)
FT                   /locus_tag="Alide_0254"
FT                   /gene_family="HOG000139378" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /codon_start="1"
FT                   /product="addiction module killer protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpr:GBP346_A0938 probable addiction module
FT                   killer protein; TIGRFAM: addiction module killer protein;
FT                   PFAM: protein of unknown function DUF891"
FT                   /db_xref="GI:319760988"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="GeneID:10102277"
FT                   QRGDE"
FT                   /protein_id="YP_004124925.1"
FT   misc_feature    complement(278265..278552)
FT                   /note="Phage derived protein Gp49-like (DUF891); Region:
FT                   Gp49; cl01470"
FT                   /db_xref="CDD:163984"
FT                   /locus_tag="Alide_0254"
FT   gene            complement(278679..280043)
FT                   /db_xref="GeneID:10102278"
FT                   /locus_tag="Alide_0255"
FT   CDS_pept        complement(278679..280043)
FT                   /locus_tag="Alide_0255"
FT                   /gene_family="HOG000289180" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: ajs:Ajs_2959
FT                   phage integrase family protein"
FT                   /db_xref="GI:319760989"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:10102278"
FT                   /protein_id="YP_004124926.1"
FT   misc_feature    complement(278910..279941)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Alide_0255"
FT   misc_feature    complement(278937..279437)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Alide_0255"
FT   misc_feature    complement(order(278946..278948,279051..279056,
FT                   279066..279068,279240..279242,279312..279317))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Alide_0255"
FT   misc_feature    complement(order(278946..278948,278973..278975,
FT                   279042..279044,279051..279053,279240..279242,
FT                   279315..279317))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Alide_0255"
FT   misc_feature    complement(order(278946..278948,278973..278975,
FT                   279042..279044,279051..279053,279315..279317))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Alide_0255"
FT   repeat_region   280252..283652
FT                   /note="CRISPRS"
FT                   /rpt_unit_range="280252..280288"
FT   gene            complement(284052..284594)
FT                   /db_xref="GeneID:10102279"
FT                   /locus_tag="Alide_0256"
FT   CDS_pept        complement(284052..284594)
FT                   /locus_tag="Alide_0256"
FT                   /gene_family="HOG000032568" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0168 shikimate kinase; PFAM:
FT                   shikimate kinase"
FT                   /db_xref="GI:319760990"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="GeneID:10102279"
FT                   MAMMQLEMAPGKPDLNT"
FT                   /product="shikimate kinase"
FT                   /protein_id="YP_004124927.1"
FT   misc_feature    complement(284079..284594)
FT                   /note="shikimate kinase; Reviewed; Region: aroK; PRK00131"
FT                   /db_xref="CDD:178887"
FT                   /locus_tag="Alide_0256"
FT   misc_feature    complement(284121..284579)
FT                   /note="Shikimate kinase (SK) is the fifth enzyme in the
FT                   shikimate pathway, a seven-step biosynthetic pathway which
FT                   converts erythrose-4-phosphate to chorismic acid, found in
FT                   bacteria, fungi and plants. Chorismic acid is a important
FT                   intermediate in the...; Region: SK; cd00464"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Alide_0256"
FT   misc_feature    complement(order(284121..284123,284235..284237,
FT                   284256..284258,284544..284561))
FT                   /note="ADP binding site; other site"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Alide_0256"
FT   misc_feature    complement(order(284493..284495,284499..284501,
FT                   284547..284549))
FT                   /note="magnesium binding site; other site"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Alide_0256"
FT   misc_feature    complement(order(284178..284180,284349..284357,
FT                   284412..284414,284421..284423,284493..284495))
FT                   /note="putative shikimate binding site; other site"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Alide_0256"
FT   gene            284700..285599
FT                   /db_xref="GeneID:10102280"
FT                   /locus_tag="Alide_0257"
FT   CDS_pept        284700..285599
FT                   /locus_tag="Alide_0257"
FT                   /gene_family="HOG000163049" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /codon_start="1"
FT                   /product="ribonuclease bn"
FT                   /transl_table="11"
FT                   /note="PFAM: ribonuclease BN; KEGG: ajs:Ajs_0151
FT                   ribonuclease BN"
FT                   /db_xref="GI:319760991"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="InterPro:IPR004664"
FT                   /db_xref="GeneID:10102280"
FT                   RALDEARTAAGAQPVGQG"
FT                   /protein_id="YP_004124928.1"
FT   misc_feature    284775..285563
FT                   /note="Ribonuclease BN-like family; Region:
FT                   Ribonuclease_BN; cl07918"
FT                   /db_xref="CDD:186712"
FT                   /locus_tag="Alide_0257"
FT   gene            285725..286441
FT                   /db_xref="GeneID:10102281"
FT                   /locus_tag="Alide_0258"
FT   CDS_pept        285725..286441
FT                   /locus_tag="Alide_0258"
FT                   /gene_family="HOG000220583" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0152"
FT                   /codon_start="1"
FT                   /product="17 kda surface antigen"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0152 17 kDa surface antigen"
FT                   /db_xref="GI:319760992"
FT                   /db_xref="GeneID:10102281"
FT                   ADRAGTQPVRVVDRGY"
FT                   /protein_id="YP_004124929.1"
FT   sig_peptide     285725..285835
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.635 at
FT                   residue 37"
FT                   /locus_tag="Alide_0258"
FT   gene            complement(286498..287271)
FT                   /db_xref="GeneID:10102282"
FT                   /locus_tag="Alide_0259"
FT   CDS_pept        complement(286498..287271)
FT                   /locus_tag="Alide_0259"
FT                   /gene_family="HOG000265759" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0153 ferredoxin--NADP(+) reductase;
FT                   PFAM: oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="GI:319760993"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="GeneID:10102282"
FT                   /product="ferredoxin--nadp(+) reductase"
FT                   /protein_id="YP_004124930.1"
FT   misc_feature    complement(286510..287271)
FT                   /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
FT                   family 1 [Energy production and conversion]; Region: Hmp;
FT                   COG1018"
FT                   /db_xref="CDD:31221"
FT                   /locus_tag="Alide_0259"
FT   misc_feature    complement(286513..287250)
FT                   /note="Ferredoxin-NADP+ (oxido)reductase is an
FT                   FAD-containing enzyme that catalyzes the reversible
FT                   electron transfer between NADP(H) and electron carrier
FT                   proteins such as ferredoxin and flavodoxin. Isoforms of
FT                   these flavoproteins (i.e. having a non-covalently...;
FT                   Region: FNR1; cd06195"
FT                   /db_xref="CDD:99792"
FT                   /locus_tag="Alide_0259"
FT   misc_feature    complement(order(286513..286515,286921..286923,
FT                   287041..287046,287050..287052,287059..287061,
FT                   287065..287067,287071..287073,287110..287121,
FT                   287161..287163))
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99792"
FT                   /locus_tag="Alide_0259"
FT   misc_feature    complement(order(287110..287115,287119..287121))
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99792"
FT                   /locus_tag="Alide_0259"
FT   misc_feature    complement(order(286981..286983,286987..286989,
FT                   287014..287016,287032..287034,287041..287043,
FT                   287050..287052))
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99792"
FT                   /locus_tag="Alide_0259"
FT   misc_feature    complement(order(286909..286911,286915..286926,
FT                   286936..286938))
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99792"
FT                   /locus_tag="Alide_0259"
FT   misc_feature    complement(order(286609..286614,286837..286845,
FT                   286918..286923))
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99792"
FT                   /locus_tag="Alide_0259"
FT   gene            287464..288660
FT                   /db_xref="GeneID:10102283"
FT                   /locus_tag="Alide_0260"
FT   CDS_pept        287464..288660
FT                   /locus_tag="Alide_0260"
FT                   /gene_family="HOG000228861" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dia:Dtpsy_0172 extracellular ligand-binding receptor"
FT                   /db_xref="GI:319760994"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:10102283"
FT                   /protein_id="YP_004124931.1"
FT   sig_peptide     287464..287529
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT                   /locus_tag="Alide_0260"
FT   misc_feature    287530..288585
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Alide_0260"
FT   misc_feature    287539..288552
FT                   /note="Periplasmic solute-binding domain of active
FT                   transport proteins; Region: PBP1_Arsenic_SBP_like; cd06330"
FT                   /db_xref="CDD:107325"
FT                   /locus_tag="Alide_0260"
FT   misc_feature    order(287758..287766,287827..287835,287977..287979,
FT                   288139..288141,288217..288219)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107325"
FT                   /locus_tag="Alide_0260"
FT   gene            288677..290575
FT                   /db_xref="GeneID:10102284"
FT                   /locus_tag="Alide_0261"
FT   CDS_pept        288677..290575
FT                   /locus_tag="Alide_0261"
FT                   /gene_family="HOG000228780" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ajs:Ajs_0155 inner-membrane translocator"
FT                   /db_xref="GI:319760995"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102284"
FT                   /protein_id="YP_004124932.1"
FT   misc_feature    288728..289570
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivH
FT                   and related proteins. LivH is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivH_like;
FT                   cd06582"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Alide_0261"
FT   misc_feature    289217..289273
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Alide_0261"
FT   misc_feature    289733..290461
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivM
FT                   and related proteins. LivM is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivM_like;
FT                   cd06581"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Alide_0261"
FT   misc_feature    290195..290251
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Alide_0261"
FT   gene            290572..292110
FT                   /db_xref="GeneID:10102285"
FT                   /locus_tag="Alide_0262"
FT   CDS_pept        290572..292110
FT                   /locus_tag="Alide_0262"
FT                   /gene_family="HOG000229903" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_0860 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319760996"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:10102285"
FT                   /protein_id="YP_004124933.1"
FT   misc_feature    290572..291303
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivG; COG0411"
FT                   /db_xref="CDD:30760"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    290581..291285
FT                   /note="The Mj1267/LivG ABC transporter subfamily is
FT                   involved in the transport of the hydrophobic amino acids
FT                   leucine, isoleucine and valine.  MJ1267 is a branched-chain
FT                   amino acid transporter with 29% similarity to both the LivF
FT                   and LivG components of the E...; Region:
FT                   ABC_Mj1267_LivG_branched; cd03219"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    290677..290700
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    order(290686..290691,290695..290703,290824..290826,
FT                   291076..291081,291178..291180)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    290815..290826
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291004..291033
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291064..291081
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291088..291099
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291166..291186
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291388..292107
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivF; COG0410"
FT                   /db_xref="CDD:30759"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291397..292077
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291493..291516
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    order(291502..291507,291511..291519,291640..291642,
FT                   291880..291885,291979..291981)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291631..291642
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291808..291837
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291868..291885
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291892..291903
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   misc_feature    291967..291987
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0262"
FT   gene            292258..295158
FT                   /db_xref="GeneID:10102286"
FT                   /locus_tag="Alide_0263"
FT   CDS_pept        292258..295158
FT                   /locus_tag="Alide_0263"
FT                   /gene_family="HOG000131249" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /codon_start="1"
FT                   /product="peptidase c1a papain"
FT                   /transl_table="11"
FT                   /note="KEGG: kpe:KPK_1160 peptidoglycan binding
FT                   domain/papain family cysteine protease; PFAM: peptidase C1A
FT                   papain; SMART: peptidase C1A papain"
FT                   /db_xref="GI:319760997"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="GeneID:10102286"
FT                   /protein_id="YP_004124934.1"
FT   misc_feature    <292261..>292479
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG2989"
FT                   /db_xref="CDD:32808"
FT                   /locus_tag="Alide_0263"
FT   misc_feature    <292738..293016
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:185840"
FT                   /locus_tag="Alide_0263"
FT   misc_feature    293311..293943
FT                   /note="C1 Peptidase family (MEROPS database nomenclature),
FT                   also referred to as the papain family; composed of two
FT                   subfamilies of cysteine peptidases (CPs), C1A (papain) and
FT                   C1B (bleomycin hydrolase). Papain-like enzymes are mostly
FT                   endopeptidases with some...; Region: Peptidase_C1; cd02619"
FT                   /db_xref="CDD:30293"
FT                   /locus_tag="Alide_0263"
FT   misc_feature    order(293323..293325,293341..293343,293809..293811,
FT                   293857..293859)
FT                   /note="active site"
FT                   /db_xref="CDD:30293"
FT                   /locus_tag="Alide_0263"
FT   gene            complement(295191..296515)
FT                   /db_xref="GeneID:10102287"
FT                   /locus_tag="Alide_0264"
FT                   /pseudo
FT   gene            complement(296512..297043)
FT                   /db_xref="GeneID:10102288"
FT                   /locus_tag="Alide_0265"
FT                   /pseudo
FT   gene            complement(297101..298636)
FT                   /db_xref="GeneID:10102289"
FT                   /locus_tag="Alide_0266"
FT   CDS_pept        complement(297101..298636)
FT                   /locus_tag="Alide_0266"
FT                   /gene_family="HOG000246698" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /codon_start="1"
FT                   /product="mg chelatase, subunit chli"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: dia:Dtpsy_0179 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="GI:319760998"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="GeneID:10102289"
FT                   /protein_id="YP_004124935.1"
FT   misc_feature    complement(297116..298594)
FT                   /note="Predicted ATPase with chaperone activity
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG0606"
FT                   /db_xref="CDD:30951"
FT                   /locus_tag="Alide_0266"
FT   misc_feature    complement(297422..298039)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Alide_0266"
FT   gene            298775..299506
FT                   /db_xref="GeneID:10102290"
FT                   /locus_tag="Alide_0267"
FT   CDS_pept        298775..299506
FT                   /locus_tag="Alide_0267"
FT                   /gene_family="HOG000286927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein chp02001"
FT                   /transl_table="11"
FT                   /note="PFAM: Conserved hypothetical protein CHP02001; KEGG:
FT                   dia:Dtpsy_0180 hypothetical protein"
FT                   /db_xref="GI:319760999"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="GeneID:10102290"
FT                   /protein_id="YP_004124936.1"
FT   sig_peptide     298775..298849
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.729 at
FT                   residue 25"
FT                   /locus_tag="Alide_0267"
FT   misc_feature    298847..299398
FT                   /note="Bacterial protein of unknown function (Gcw_chp);
FT                   Region: Gcw_chp; cl09901"
FT                   /db_xref="CDD:164168"
FT                   /locus_tag="Alide_0267"
FT   gene            299526..299864
FT                   /db_xref="GeneID:10102291"
FT                   /locus_tag="Alide_0268"
FT   CDS_pept        299526..299864
FT                   /locus_tag="Alide_0268"
FT                   /gene_family="HOG000017847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /codon_start="1"
FT                   /product="nitrogen regulatory protein p-ii"
FT                   /transl_table="11"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   aav:Aave_0233 nitrogen regulatory protein P-II"
FT                   /db_xref="GI:319761000"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="GeneID:10102291"
FT                   GETGGQAL"
FT                   /protein_id="YP_004124937.1"
FT   misc_feature    299535..299840
FT                   /note="Nitrogen regulatory protein P-II; Region: P-II;
FT                   cl00412"
FT                   /db_xref="CDD:185979"
FT                   /locus_tag="Alide_0268"
FT   gene            299887..301275
FT                   /db_xref="GeneID:10102292"
FT                   /locus_tag="Alide_0269"
FT   CDS_pept        299887..301275
FT                   /locus_tag="Alide_0269"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /codon_start="1"
FT                   /product="ammonium transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0164 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="GI:319761001"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="GeneID:10102292"
FT                   AYHR"
FT                   /protein_id="YP_004124938.1"
FT   sig_peptide     299887..299958
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.964 at
FT                   residue 24"
FT                   /locus_tag="Alide_0269"
FT   misc_feature    300055..301272
FT                   /note="Ammonium Transporter Family; Region:
FT                   Ammonium_transp; cl03012"
FT                   /db_xref="CDD:186546"
FT                   /locus_tag="Alide_0269"
FT   gene            301369..302247
FT                   /db_xref="GeneID:10102293"
FT                   /locus_tag="Alide_0270"
FT   CDS_pept        301369..302247
FT                   /locus_tag="Alide_0270"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rme:Rmet_5424 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319761002"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102293"
FT                   KDWLMVEAMKK"
FT                   /protein_id="YP_004124939.1"
FT   misc_feature    301372..302235
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:182990"
FT                   /locus_tag="Alide_0270"
FT   misc_feature    301384..301563
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0270"
FT   misc_feature    301645..302223
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Alide_0270"
FT   misc_feature    order(301645..301668,301672..301725,301729..301749)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Alide_0270"
FT   misc_feature    order(301663..301668,301672..301674,302020..302028,
FT                   302086..302088)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Alide_0270"
FT   gene            complement(302321..303196)
FT                   /db_xref="GeneID:10102294"
FT                   /locus_tag="Alide_0271"
FT   CDS_pept        complement(302321..303196)
FT                   /locus_tag="Alide_0271"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4431 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761003"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102294"
FT                   PVIYRLVEKQ"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /protein_id="YP_004124940.1"
FT   misc_feature    complement(<302660..303181)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0271"
FT   misc_feature    complement(302705..303181)
FT                   /note="NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase; Region: NAD_binding_2; pfam03446"
FT                   /db_xref="CDD:146202"
FT                   /locus_tag="Alide_0271"
FT   gene            complement(303193..304623)
FT                   /db_xref="GeneID:10102295"
FT                   /locus_tag="Alide_0272"
FT   CDS_pept        complement(303193..304623)
FT                   /locus_tag="Alide_0272"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: amd:AMED_3840
FT                   succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /db_xref="GI:319761004"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="GeneID:10102295"
FT                   EGLMEFLRVKCVRQGVQA"
FT                   /protein_id="YP_004124941.1"
FT   misc_feature    complement(303214..304560)
FT                   /note="Mitochondrial succinate-semialdehyde dehydrogenase
FT                   and ALDH family members 5A1 and 5F1-like; Region:
FT                   ALDH_F5_SSADH_GabD; cd07103"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Alide_0272"
FT   misc_feature    complement(order(303214..303228,303262..303264,
FT                   303277..303279,303295..303300,303307..303309,
FT                   303325..303345,303349..303351,303358..303360,
FT                   303364..303366,303376..303381,303385..303387,
FT                   303589..303591,303727..303729,303739..303741,
FT                   303910..303912,303919..303921,303931..303933,
FT                   303967..303969,304213..304215,304228..304236,
FT                   304252..304278,304282..304287,304294..304296,
FT                   304417..304419,304444..304446))
FT                   /note="tetramerization interface; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Alide_0272"
FT   misc_feature    complement(order(303292..303294,303406..303408,
FT                   303484..303486,303490..303492,303781..303783,
FT                   303877..303885,303925..303930,303937..303939,
FT                   303946..303957,304099..304104,304108..304110,
FT                   304153..304155,304177..304191))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Alide_0272"
FT   misc_feature    complement(order(303781..303783,303790..303792,
FT                   303883..303885,304177..304179))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Alide_0272"
FT   gene            complement(304623..305603)
FT                   /db_xref="GeneID:10102296"
FT                   /locus_tag="Alide_0273"
FT   CDS_pept        complement(304623..305603)
FT                   /locus_tag="Alide_0273"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BB3069"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbr:BB3069 hypothetical protein"
FT                   /db_xref="GI:319761005"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="GeneID:10102296"
FT                   /protein_id="YP_004124942.1"
FT   sig_peptide     complement(305529..305603)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.773 at
FT                   residue 25"
FT                   /locus_tag="Alide_0273"
FT   misc_feature    complement(304635..305453)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0273"
FT   gene            complement(305633..306412)
FT                   /db_xref="GeneID:10102297"
FT                   /locus_tag="Alide_0274"
FT   CDS_pept        complement(305633..306412)
FT                   /locus_tag="Alide_0274"
FT                   /gene_family="HOG000144809" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3256"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_3256 beta-lactamase
FT                   domain-containing protein"
FT                   /db_xref="GI:319761006"
FT                   /db_xref="GeneID:10102297"
FT                   /protein_id="YP_004124943.1"
FT   misc_feature    complement(305702..306295)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:186000"
FT                   /locus_tag="Alide_0274"
FT   gene            complement(306409..307635)
FT                   /db_xref="GeneID:10102298"
FT                   /locus_tag="Alide_0275"
FT   CDS_pept        complement(306409..307635)
FT                   /locus_tag="Alide_0275"
FT                   /gene_family="HOG000253828" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B3887"
FT                   /codon_start="1"
FT                   /product="urea/short-chain amide abc transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B3887 UreA/short-chain amide ABC
FT                   transporter"
FT                   /db_xref="GI:319761007"
FT                   /db_xref="GeneID:10102298"
FT                   ESKCPLLKP"
FT                   /protein_id="YP_004124944.1"
FT   sig_peptide     complement(307573..307635)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.294 at
FT                   residue 21"
FT                   /locus_tag="Alide_0275"
FT   misc_feature    complement(306487..307557)
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Alide_0275"
FT   misc_feature    complement(306532..307530)
FT                   /note="Periplasmic solute-binding domain of active
FT                   transport proteins that belong to the type I periplasmic
FT                   binding fold protein family; Region: PBP1_SBP_like_1;
FT                   cd06327"
FT                   /db_xref="CDD:107322"
FT                   /locus_tag="Alide_0275"
FT   misc_feature    complement(order(306853..306855,306934..306936,
FT                   307090..307092,307234..307242,307303..307311))
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107322"
FT                   /locus_tag="Alide_0275"
FT   gene            complement(307797..308687)
FT                   /db_xref="GeneID:10102299"
FT                   /locus_tag="Alide_0276"
FT   CDS_pept        complement(307797..308687)
FT                   /locus_tag="Alide_0276"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_04058 hypothetical protein; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761008"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102299"
FT                   TDFWAESNGQPPVRL"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /protein_id="YP_004124945.1"
FT   misc_feature    complement(307851..308687)
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Alide_0276"
FT   misc_feature    complement(<308166..308687)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0276"
FT   gene            complement(308684..309544)
FT                   /db_xref="GeneID:10102300"
FT                   /locus_tag="Alide_0277"
FT   CDS_pept        complement(308684..309544)
FT                   /locus_tag="Alide_0277"
FT                   /gene_family="HOG000076805" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   msm:MSMEG_2534 carboxylesterase protein"
FT                   /db_xref="GI:319761009"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102300"
FT                   NEGNT"
FT                   /protein_id="YP_004124946.1"
FT   misc_feature    complement(308708..309502)
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Alide_0277"
FT   misc_feature    complement(308741..309364)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Alide_0277"
FT   gene            complement(309534..309884)
FT                   /db_xref="GeneID:10102301"
FT                   /locus_tag="Alide_0278"
FT   CDS_pept        complement(309534..309884)
FT                   /locus_tag="Alide_0278"
FT                   /gene_family="HOG000166471" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tcur_0017"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tcu:Tcur_0017 hypothetical protein"
FT                   /db_xref="GI:319761010"
FT                   /db_xref="GeneID:10102301"
FT                   LVKQLGGHIHAR"
FT                   /protein_id="YP_004124947.1"
FT   gene            complement(309967..311034)
FT                   /db_xref="GeneID:10102302"
FT                   /locus_tag="Alide_0279"
FT   CDS_pept        complement(309967..311034)
FT                   /locus_tag="Alide_0279"
FT                   /gene_family="HOG000247836" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /codon_start="1"
FT                   /product="membrane protein abrb duplication"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_4786 membrane protein AbrB
FT                   duplication; TIGRFAM: membrane protein AbrB duplication;
FT                   PFAM: ammonia monooxygenase"
FT                   /db_xref="GI:319761011"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="GeneID:10102302"
FT                   LVLVRPAYRLWARQP"
FT                   /protein_id="YP_004124948.1"
FT   misc_feature    complement(310537..310977)
FT                   /note="membrane protein AbrB duplication; Region:
FT                   Gneg_AbrB_dup; TIGR03082"
FT                   /db_xref="CDD:163128"
FT                   /locus_tag="Alide_0279"
FT   misc_feature    complement(309970..310947)
FT                   /note="Putative ammonia monooxygenase; Region: AmoA;
FT                   pfam05145"
FT                   /db_xref="CDD:113899"
FT                   /locus_tag="Alide_0279"
FT   misc_feature    complement(310054..310389)
FT                   /note="membrane protein AbrB duplication; Region:
FT                   Gneg_AbrB_dup; TIGR03082"
FT                   /db_xref="CDD:163128"
FT                   /locus_tag="Alide_0279"
FT   gene            complement(311037..312383)
FT                   /db_xref="GeneID:10102303"
FT                   /locus_tag="Alide_0280"
FT   CDS_pept        complement(311037..312383)
FT                   /locus_tag="Alide_0280"
FT                   /gene_family="HOG000267405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /codon_start="1"
FT                   /product="mmge/prpd family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: vei:Veis_3318
FT                   MmgE/PrpD family protein"
FT                   /db_xref="GI:319761012"
FT                   /db_xref="GO:0047547"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="GeneID:10102303"
FT                   /protein_id="YP_004124949.1"
FT   misc_feature    complement(311055..312317)
FT                   /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
FT                   /db_xref="CDD:186254"
FT                   /locus_tag="Alide_0280"
FT   gene            312538..313692
FT                   /db_xref="GeneID:10102304"
FT                   /locus_tag="Alide_0281"
FT   CDS_pept        312538..313692
FT                   /locus_tag="Alide_0281"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: rme:Rmet_5425 butyryl-CoA dehydrogenase"
FT                   /db_xref="GI:319761013"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102304"
FT                   /protein_id="YP_004124950.1"
FT   misc_feature    312538..313671
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0281"
FT   misc_feature    312556..313647
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cd00567"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0281"
FT   misc_feature    order(312691..312693,312904..312906,312910..312912,
FT                   313003..313005,313009..313011,313603..313611,
FT                   313615..313617,313621..313623)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0281"
FT   gene            313716..314690
FT                   /db_xref="GeneID:10102305"
FT                   /locus_tag="Alide_0282"
FT   CDS_pept        313716..314690
FT                   /locus_tag="Alide_0282"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Veis_3320"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_3320 hypothetical protein"
FT                   /db_xref="GI:319761014"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102305"
FT                   /protein_id="YP_004124951.1"
FT   sig_peptide     313716..313790
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.862 at
FT                   residue 25"
FT                   /locus_tag="Alide_0282"
FT   misc_feature    313857..314678
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0282"
FT   gene            314687..316762
FT                   /db_xref="GeneID:10102306"
FT                   /locus_tag="Alide_0283"
FT   CDS_pept        314687..316762
FT                   /locus_tag="Alide_0283"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /codon_start="1"
FT                   /product="CoA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   dac:Daci_1885 CoA-binding domain-containing protein"
FT                   /db_xref="GI:319761015"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="GeneID:10102306"
FT                   /protein_id="YP_004124952.1"
FT   misc_feature    314699..>314989
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0283"
FT   misc_feature    314723..316048
FT                   /note="acetyl coenzyme A synthetase (ADP forming), alpha
FT                   domain; Region: AcCoA-syn-alpha; TIGR02717"
FT                   /db_xref="CDD:131764"
FT                   /locus_tag="Alide_0283"
FT   misc_feature    316184..>316735
FT                   /note="Acyl-CoA synthetase (NDP forming) [Energy production
FT                   and conversion]; Region: COG1042"
FT                   /db_xref="CDD:31244"
FT                   /locus_tag="Alide_0283"
FT   gene            316836..317948
FT                   /db_xref="GeneID:10102307"
FT                   /locus_tag="Alide_0284"
FT   CDS_pept        316836..317948
FT                   /locus_tag="Alide_0284"
FT                   /gene_family="HOG000230994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="fad linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dia:Dtpsy_0184 FAD linked oxidase domain protein"
FT                   /db_xref="GI:319761016"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="GeneID:10102307"
FT                   /protein_id="YP_004124953.1"
FT   misc_feature    316845..317942
FT                   /note="glycolate oxidase FAD binding subunit; Provisional;
FT                   Region: glcE; PRK11282"
FT                   /db_xref="CDD:183074"
FT                   /locus_tag="Alide_0284"
FT   misc_feature    316854..317246
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Alide_0284"
FT   gene            317951..318724
FT                   /db_xref="GeneID:10102308"
FT                   /locus_tag="Alide_0285"
FT   CDS_pept        317951..318724
FT                   /locus_tag="Alide_0285"
FT                   /gene_family="HOG000268664" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   dia:Dtpsy_0185 protein of unknown function DUF1275"
FT                   /db_xref="GI:319761017"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="GeneID:10102308"
FT                   /protein_id="YP_004124954.1"
FT   misc_feature    318068..318559
FT                   /note="Protein of unknown function (DUF1275); Region:
FT                   DUF1275; cl01453"
FT                   /db_xref="CDD:154409"
FT                   /locus_tag="Alide_0285"
FT   gene            318761..319999
FT                   /db_xref="GeneID:10102309"
FT                   /locus_tag="Alide_0286"
FT   CDS_pept        318761..319999
FT                   /locus_tag="Alide_0286"
FT                   /gene_family="HOG000256469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: ajs:Ajs_0168
FT                   glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="GI:319761018"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:10102309"
FT                   RHWVELLDEALLA"
FT                   /protein_id="YP_004124955.1"
FT   misc_feature    318761..319996
FT                   /note="glycolate oxidase iron-sulfur subunit; Provisional;
FT                   Region: glcF; PRK11274"
FT                   /db_xref="CDD:183069"
FT                   /locus_tag="Alide_0286"
FT   misc_feature    <318785..>319108
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl14655"
FT                   /db_xref="CDD:187409"
FT                   /locus_tag="Alide_0286"
FT   misc_feature    319733..319936
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="Alide_0286"
FT   gene            320062..320793
FT                   /db_xref="GeneID:10102310"
FT                   /locus_tag="Alide_0287"
FT   CDS_pept        320062..320793
FT                   /locus_tag="Alide_0287"
FT                   /gene_family="HOG000228951" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04352"
FT                   /codon_start="1"
FT                   /product="fertility inhibition fino-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Fertility inhibition FinO-like; KEGG:
FT                   dia:Dtpsy_0187 ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /db_xref="GI:319761019"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="GeneID:10102310"
FT                   /protein_id="YP_004124956.1"
FT   misc_feature    320170..320484
FT                   /note="FinO bacterial conjugation repressor domain;  the
FT                   basic protein FinO is part of the the two component FinOP
FT                   system which is responsible for repressing bacterial
FT                   conjugation; the FinOP system represses the transfer (tra)
FT                   operon of the F-plasmid which...; Region: FinO_conjug_rep;
FT                   cl00174"
FT                   /db_xref="CDD:185810"
FT                   /locus_tag="Alide_0287"
FT   gene            complement(320851..321735)
FT                   /db_xref="GeneID:10102311"
FT                   /locus_tag="Alide_0288"
FT   CDS_pept        complement(320851..321735)
FT                   /locus_tag="Alide_0288"
FT                   /gene_family="HOG000261801" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0174 hypothetical protein"
FT                   /db_xref="GI:319761020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:10102311"
FT                   AATWSAWRPRARG"
FT                   /protein_id="YP_004124957.1"
FT   misc_feature    complement(321331..321693)
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Alide_0288"
FT   gene            complement(321789..323066)
FT                   /db_xref="GeneID:10102312"
FT                   /locus_tag="Alide_0289"
FT   CDS_pept        complement(321789..323066)
FT                   /locus_tag="Alide_0289"
FT                   /gene_family="HOG000261823" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dia:Dtpsy_0193 lysophospholipid transporter LplT"
FT                   /db_xref="GI:319761021"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102312"
FT                   /protein_id="YP_004124958.1"
FT   misc_feature    complement(321828..323066)
FT                   /note="lysophospholipid transporter LplT; Provisional;
FT                   Region: PRK11195"
FT                   /db_xref="CDD:183032"
FT                   /locus_tag="Alide_0289"
FT   gene            323210..324304
FT                   /db_xref="GeneID:10102313"
FT                   /locus_tag="Alide_0290"
FT   CDS_pept        323210..324304
FT                   /locus_tag="Alide_0290"
FT                   /gene_family="HOG000031446" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: alanine racemase; KEGG: ajs:Ajs_0176
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="GI:319761022"
FT                   /db_xref="GO:0008784"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="GeneID:10102313"
FT                   /product="alanine racemase"
FT                   /protein_id="YP_004124959.1"
FT   misc_feature    323216..324295
FT                   /note="alanine racemase; Reviewed; Region: dadX; PRK03646"
FT                   /db_xref="CDD:179622"
FT                   /locus_tag="Alide_0290"
FT   misc_feature    323219..324292
FT                   /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
FT                   Enzymes, Proteobacterial Alanine Racemases; Region:
FT                   PLPDE_III_AR_proteobact; cd06827"
FT                   /db_xref="CDD:143500"
FT                   /locus_tag="Alide_0290"
FT   misc_feature    order(323306..323308,323312..323314,323324..323326,
FT                   323444..323446,323576..323578,323597..323599,
FT                   323678..323680,323684..323686,323780..323788,
FT                   323837..323848,324254..324256)
FT                   /note="active site"
FT                   /db_xref="CDD:143500"
FT                   /locus_tag="Alide_0290"
FT   misc_feature    order(323306..323308,323312..323314,323324..323326,
FT                   323444..323446,323684..323686,323780..323785,
FT                   323837..323839,323843..323848,324254..324256)
FT                   /note="pyridoxal 5'-phosphate (PLP) binding site; other
FT                   site"
FT                   /db_xref="CDD:143500"
FT                   /locus_tag="Alide_0290"
FT   misc_feature    order(323312..323314,323324..323326,323597..323599,
FT                   323684..323686,324254..324256)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:143500"
FT                   /locus_tag="Alide_0290"
FT   misc_feature    order(323312..323314,323975..323977)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143500"
FT                   /locus_tag="Alide_0290"
FT   misc_feature    order(323936..323938,323945..323947,323963..323968,
FT                   323972..323980,324017..324019,324032..324034,
FT                   324050..324052,324116..324118,324122..324124,
FT                   324248..324250,324254..324259,324272..324274,
FT                   324281..324283)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143500"
FT                   /locus_tag="Alide_0290"
FT   gene            324523..325542
FT                   /db_xref="GeneID:10102314"
FT                   /locus_tag="Alide_0291"
FT   CDS_pept        324523..325542
FT                   /locus_tag="Alide_0291"
FT                   /gene_family="HOG000173945" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0196 cytochrome-c peroxidase; PFAM:
FT                   Di-haem cytochrome c peroxidase"
FT                   /db_xref="GI:319761023"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:10102314"
FT                   /product="cytochrome-c peroxidase"
FT                   /protein_id="YP_004124960.1"
FT   sig_peptide     324523..324621
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT                   /locus_tag="Alide_0291"
FT   misc_feature    324658..325500
FT                   /note="tryptophan tryptophylquinone biosynthesis enzyme
FT                   MauG; Region: TTQ_mauG; TIGR03791"
FT                   /db_xref="CDD:163503"
FT                   /locus_tag="Alide_0291"
FT   misc_feature    324658..325116
FT                   /note="Di-haem cytochrome c peroxidase; Region: CCP_MauG;
FT                   pfam03150"
FT                   /db_xref="CDD:145996"
FT                   /locus_tag="Alide_0291"
FT   misc_feature    325162..>325377
FT                   /note="Di-haem cytochrome c peroxidase; Region: CCP_MauG;
FT                   pfam03150"
FT                   /db_xref="CDD:145996"
FT                   /locus_tag="Alide_0291"
FT   gene            complement(325622..326236)
FT                   /db_xref="GeneID:10102315"
FT                   /locus_tag="Alide_0292"
FT   CDS_pept        complement(325622..326236)
FT                   /locus_tag="Alide_0292"
FT                   /gene_family="HOG000125748" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="glutathione s-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dia:Dtpsy_0197 glutathione S-transferase domain protein"
FT                   /db_xref="GI:319761024"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="GeneID:10102315"
FT                   /protein_id="YP_004124961.1"
FT   misc_feature    complement(325631..326227)
FT                   /note="Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: Gst;
FT                   COG0625"
FT                   /db_xref="CDD:30970"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(326003..326227)
FT                   /note="GST_N family, Class Beta subfamily; GSTs are
FT                   cytosolic dimeric proteins involved in cellular
FT                   detoxification by catalyzing the conjugation of glutathione
FT                   (GSH) with a wide range of endogenous and xenobiotic
FT                   alkylating agents, including carcinogens...; Region:
FT                   GST_N_Beta; cd03057"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(order(326009..326011,326021..326023,
FT                   326168..326173,326183..326185,326189..326191,
FT                   326204..326209))
FT                   /note="C-terminal domain interface; other site"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(order(326036..326041,326075..326080,
FT                   326198..326200))
FT                   /note="GSH binding site (G-site); other site"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(order(326009..326011,326018..326020,
FT                   326033..326035,326039..326044,326078..326080))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48606"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(325628..325972)
FT                   /note="GST_C family, Class Beta subfamily; GSTs are
FT                   cytosolic dimeric proteins involved in cellular
FT                   detoxification by catalyzing the conjugation of glutathione
FT                   (GSH) with a wide range of endogenous and xenobiotic
FT                   alkylating agents, including carcinogens...; Region:
FT                   GST_C_Beta; cd03188"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(order(325832..325834,325844..325846,
FT                   325853..325855,325889..325891,325916..325918,
FT                   325928..325930,325940..325942,325949..325951,
FT                   325958..325963,325970..325972))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(order(325631..325633,325643..325645,
FT                   325649..325651,325721..325723,325733..325735,
FT                   325754..325756,325919..325921,325964..325966))
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0292"
FT   misc_feature    complement(order(325712..325714,325721..325723,
FT                   325730..325732,325898..325900,325904..325909,
FT                   325916..325921,325931..325933))
FT                   /note="substrate binding pocket (H-site); other site"
FT                   /db_xref="CDD:48115"
FT                   /locus_tag="Alide_0292"
FT   gene            326367..327749
FT                   /db_xref="GeneID:10102316"
FT                   /locus_tag="Alide_0293"
FT   CDS_pept        326367..327749
FT                   /locus_tag="Alide_0293"
FT                   /gene_family="HOG000218329" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /codon_start="1"
FT                   /product="DNA repair protein rada"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0199 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="GI:319761025"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="GeneID:10102316"
FT                   LG"
FT                   /protein_id="YP_004124962.1"
FT   misc_feature    326367..327743
FT                   /note="DNA repair protein RadA; Provisional; Region:
FT                   PRK11823"
FT                   /db_xref="CDD:183326"
FT                   /locus_tag="Alide_0293"
FT   misc_feature    326388..327515
FT                   /note="Sms (bacterial radA) DNA repair protein. This
FT                   protein is not related to archael radA any more than is to
FT                   other RecA-like NTPases. Sms has a role in recombination
FT                   and recombinational repair and is responsible for the
FT                   stabilization or processing of...; Region: Sms; cd01121"
FT                   /db_xref="CDD:29987"
FT                   /locus_tag="Alide_0293"
FT   misc_feature    326667..326690
FT                   /note="Walker A motif/ATP binding site; other site"
FT                   /db_xref="CDD:29987"
FT                   /locus_tag="Alide_0293"
FT   misc_feature    order(326670..326672,326682..326690,326745..326747,
FT                   326751..326753,326895..326900)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29987"
FT                   /locus_tag="Alide_0293"
FT   misc_feature    326886..326897
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29987"
FT                   /locus_tag="Alide_0293"
FT   misc_feature    <327474..327719
FT                   /note="Lon protease (S16) C-terminal proteolytic domain;
FT                   Region: Lon_C; pfam05362"
FT                   /db_xref="CDD:114104"
FT                   /locus_tag="Alide_0293"
FT   gene            complement(327753..328739)
FT                   /db_xref="GeneID:10102317"
FT                   /locus_tag="Alide_0294"
FT   CDS_pept        complement(327753..328739)
FT                   /locus_tag="Alide_0294"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1769"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1769 hypothetical protein"
FT                   /db_xref="GI:319761026"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102317"
FT                   /protein_id="YP_004124963.1"
FT   sig_peptide     complement(328653..328739)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT                   /locus_tag="Alide_0294"
FT   misc_feature    complement(327771..328592)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0294"
FT   gene            complement(328764..330188)
FT                   /db_xref="GeneID:10102318"
FT                   /locus_tag="Alide_0295"
FT   CDS_pept        complement(328764..330188)
FT                   /locus_tag="Alide_0295"
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /codon_start="1"
FT                   /product="amidase"
FT                   /transl_table="11"
FT                   /note="PFAM: Amidase; KEGG: reh:H16_A1882 Asp-tRNA Asn /
FT                   Glu-tRNA Gln amidotransferase A subunit or related amidase"
FT                   /db_xref="GI:319761027"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="GeneID:10102318"
FT                   CLEASFNLLQAWPDMS"
FT                   /protein_id="YP_004124964.1"
FT   misc_feature    complement(328770..330161)
FT                   /note="putative amidase; Provisional; Region: PRK06169"
FT                   /db_xref="CDD:180437"
FT                   /locus_tag="Alide_0295"
FT   misc_feature    complement(328827..330113)
FT                   /note="GGCT-like domains, also called AIG2-like family.
FT                   Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
FT                   formation of pyroglutamic acid (5-oxoproline) from
FT                   dipeptides containing gamma-glutamyl, and is a dimeric
FT                   protein. In Homo sapiens, the protein is...; Region:
FT                   GGCT_like; cl11426"
FT                   /db_xref="CDD:187035"
FT                   /locus_tag="Alide_0295"
FT   gene            330354..330770
FT                   /db_xref="GeneID:10102319"
FT                   /locus_tag="Alide_0296"
FT   CDS_pept        330354..330770
FT                   /locus_tag="Alide_0296"
FT                   /gene_family="HOG000224916" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0181"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0181 hypothetical protein"
FT                   /db_xref="GI:319761028"
FT                   /db_xref="GeneID:10102319"
FT                   /protein_id="YP_004124965.1"
FT   sig_peptide     330354..330422
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.621) with cleavage site probability 0.518 at
FT                   residue 23"
FT                   /locus_tag="Alide_0296"
FT   gene            330815..331753
FT                   /db_xref="GeneID:10102320"
FT                   /locus_tag="Alide_0297"
FT   CDS_pept        330815..331753
FT                   /locus_tag="Alide_0297"
FT                   /gene_family="HOG000276706" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0182 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="GI:319761029"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="GeneID:10102320"
FT                   /protein_id="YP_004124966.1"
FT   misc_feature    330896..331714
FT                   /note="BCAT_beta_family: Branched-chain aminotransferase
FT                   catalyses the transamination of the branched-chain amino
FT                   acids  leusine, isoleucine and valine to their respective
FT                   alpha-keto acids, alpha-ketoisocaproate,
FT                   alpha-keto-beta-methylvalerate and alpha-...; Region:
FT                   BCAT_beta_family; cd01557"
FT                   /db_xref="CDD:29568"
FT                   /locus_tag="Alide_0297"
FT   misc_feature    order(330896..330910,330917..330931,330935..330937,
FT                   330941..330943,331031..331033,331124..331126,
FT                   331130..331132,331148..331156,331166..331168,
FT                   331190..331192,331313..331315,331328..331330,
FT                   331334..331336,331346..331348,331388..331390)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:29568"
FT                   /locus_tag="Alide_0297"
FT   misc_feature    order(330926..330928,330941..330943,331010..331012,
FT                   331160..331162,331307..331309,331322..331324,
FT                   331409..331411,331490..331495,331601..331603)
FT                   /note="substrate-cofactor binding pocket; other site"
FT                   /db_xref="CDD:29568"
FT                   /locus_tag="Alide_0297"
FT   misc_feature    330986..331696
FT                   /note="Aminotransferase class IV; Region: Aminotran_4;
FT                   pfam01063"
FT                   /db_xref="CDD:144598"
FT                   /locus_tag="Alide_0297"
FT   misc_feature    331307..331309
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29568"
FT                   /locus_tag="Alide_0297"
FT   gene            331761..331967
FT                   /db_xref="GeneID:10102321"
FT                   /locus_tag="Alide_0298"
FT   CDS_pept        331761..331967
FT                   /locus_tag="Alide_0298"
FT                   /gene_family="HOG000263985" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10276"
FT                   /codon_start="1"
FT                   /product="zinc finger, chcc-type"
FT                   /transl_table="11"
FT                   /note="PFAM: Zinc finger, CHCC-type; KEGG: ajs:Ajs_0183
FT                   hypothetical protein"
FT                   /db_xref="GI:319761030"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="GeneID:10102321"
FT                   /protein_id="YP_004124967.1"
FT   misc_feature    <331815..331934
FT                   /note="Zinc-finger domain; Region: zf-CHCC; cl01821"
FT                   /db_xref="CDD:154607"
FT                   /locus_tag="Alide_0298"
FT   gene            332042..333394
FT                   /db_xref="GeneID:10102322"
FT                   /locus_tag="Alide_0299"
FT   CDS_pept        332042..333394
FT                   /locus_tag="Alide_0299"
FT                   /gene_family="HOG000224918" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /codon_start="1"
FT                   /product="o-antigen polymerase"
FT                   /transl_table="11"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ajs:Ajs_0184
FT                   O-antigen polymerase"
FT                   /db_xref="GI:319761031"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="GeneID:10102322"
FT                   /protein_id="YP_004124968.1"
FT   misc_feature    332636..333076
FT                   /note="O-Antigen ligase; Region: Wzy_C; cl04850"
FT                   /db_xref="CDD:186638"
FT                   /locus_tag="Alide_0299"
FT   misc_feature    <332861..333301
FT                   /note="Lipid A core - O-antigen ligase and related enzymes
FT                   [Cell envelope biogenesis, outer membrane]; Region: RfaL;
FT                   COG3307"
FT                   /db_xref="CDD:33116"
FT                   /locus_tag="Alide_0299"
FT   gene            333387..334502
FT                   /db_xref="GeneID:10102323"
FT                   /locus_tag="Alide_0300"
FT   CDS_pept        333387..334502
FT                   /locus_tag="Alide_0300"
FT                   /gene_family="HOG000224919" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ajs:Ajs_0185 glycosyl transferase, group 1"
FT                   /db_xref="GI:319761032"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:10102323"
FT                   /protein_id="YP_004124969.1"
FT   misc_feature    333411..334376
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. WabH in Klebsiella
FT                   pneumoniae has been shown to transfer a GlcNAc residue from
FT                   UDP-GlcNAc onto the acceptor GalUA residue in the cellular
FT                   outer core; Region: GT1_WabH_like; cd03811"
FT                   /db_xref="CDD:99982"
FT                   /locus_tag="Alide_0300"
FT   misc_feature    333414..334490
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="Alide_0300"
FT   misc_feature    order(333444..333446,333969..333977,334161..334163,
FT                   334227..334229)
FT                   /note="putative ADP-binding pocket; other site"
FT                   /db_xref="CDD:99982"
FT                   /locus_tag="Alide_0300"
FT   gene            334499..335545
FT                   /db_xref="GeneID:10102324"
FT                   /locus_tag="Alide_0301"
FT   CDS_pept        334499..335545
FT                   /locus_tag="Alide_0301"
FT                   /gene_family="HOG000224920" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ajs:Ajs_0186 glycosyl transferase family protein"
FT                   /db_xref="GI:319761033"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:10102324"
FT                   RAWSTVSA"
FT                   /protein_id="YP_004124970.1"
FT   misc_feature    334523..>335155
FT                   /note="Predicted glycosyltransferases [General function
FT                   prediction only]; Region: COG1216"
FT                   /db_xref="CDD:31409"
FT                   /locus_tag="Alide_0301"
FT   misc_feature    334529..>334813
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Alide_0301"
FT   misc_feature    order(334538..334540,334544..334546,334640..334642,
FT                   334802..334804,334808..334810)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Alide_0301"
FT   gene            335542..336516
FT                   /db_xref="GeneID:10102325"
FT                   /locus_tag="Alide_0302"
FT   CDS_pept        335542..336516
FT                   /locus_tag="Alide_0302"
FT                   /gene_family="HOG000224917" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0187"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0187 hypothetical protein"
FT                   /db_xref="GI:319761034"
FT                   /db_xref="GeneID:10102325"
FT                   /protein_id="YP_004124971.1"
FT   misc_feature    335749..335970
FT                   /note="Glycosyltransferase sugar-binding region containing
FT                   DXD motif; Region: Gly_transf_sug; pfam04488"
FT                   /db_xref="CDD:146897"
FT                   /locus_tag="Alide_0302"
FT   gene            complement(336585..337649)
FT                   /db_xref="GeneID:10102326"
FT                   /locus_tag="Alide_0303"
FT   CDS_pept        complement(336585..337649)
FT                   /locus_tag="Alide_0303"
FT                   /gene_family="HOG000123287" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /codon_start="1"
FT                   /product="2-nitropropane dioxygenase npd"
FT                   /transl_table="11"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   ajs:Ajs_0188 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="GI:319761035"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="GeneID:10102326"
FT                   LAQEWRAALQRLQA"
FT                   /protein_id="YP_004124972.1"
FT   misc_feature    complement(336618..337643)
FT                   /note="2-nitropropane dioxygenase; Region: NPD; pfam03060"
FT                   /db_xref="CDD:145943"
FT                   /locus_tag="Alide_0303"
FT   misc_feature    complement(336813..337619)
FT                   /note="2-Nitropropane dioxygenase (NPD), one of the
FT                   nitroalkane oxidizing enzyme families, catalyzes oxidative
FT                   denitrification of nitroalkanes to their corresponding
FT                   carbonyl compounds and nitrites. NDP is a member of the
FT                   NAD(P)H-dependent flavin...; Region: NPD_like; cd04730"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Alide_0303"
FT   misc_feature    complement(order(336939..336950,337005..337013,
FT                   337116..337121,337131..337133,337194..337196,
FT                   337263..337265,337437..337439,337590..337595))
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Alide_0303"
FT   misc_feature    complement(337110..337115)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Alide_0303"
FT   misc_feature    complement(337110..337112)
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Alide_0303"
FT   gene            complement(337646..338512)
FT                   /db_xref="GeneID:10102327"
FT                   /locus_tag="Alide_0304"
FT   CDS_pept        complement(337646..338512)
FT                   /locus_tag="Alide_0304"
FT                   /gene_family="HOG000233521" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0189 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319761036"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102327"
FT                   LSHQDAP"
FT                   /protein_id="YP_004124973.1"
FT   misc_feature    complement(338327..338506)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0304"
FT   misc_feature    complement(337697..338245)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0304"
FT   misc_feature    complement(order(337823..337828,337832..337837,
FT                   337853..337870,338141..338161,338165..338167,
FT                   338177..338179,338186..338191,338195..338200))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Alide_0304"
FT   gene            338568..339797
FT                   /db_xref="GeneID:10102328"
FT                   /locus_tag="Alide_0305"
FT   CDS_pept        338568..339797
FT                   /locus_tag="Alide_0305"
FT                   /gene_family="HOG000259245" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0209"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0209 protein of unknown function
FT                   DUF1228"
FT                   /db_xref="GI:319761037"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="GeneID:10102328"
FT                   ASAWRWPLVR"
FT                   /protein_id="YP_004124974.1"
FT   misc_feature    338634..338909
FT                   /note="Protein of unknown function (DUF1228); Region:
FT                   DUF1228; pfam06779"
FT                   /db_xref="CDD:115437"
FT                   /locus_tag="Alide_0305"
FT   gene            complement(339801..340520)
FT                   /db_xref="GeneID:10102329"
FT                   /locus_tag="Alide_0306"
FT   CDS_pept        complement(339801..340520)
FT                   /locus_tag="Alide_0306"
FT                   /gene_family="HOG000051122" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /codon_start="1"
FT                   /product="mosc domain containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   dia:Dtpsy_0210 MOSC domain containing protein"
FT                   /db_xref="GI:319761038"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="GeneID:10102329"
FT                   ENASAEDWTSRLVGRQP"
FT                   /protein_id="YP_004124975.1"
FT   misc_feature    complement(339846..340490)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG2258"
FT                   /db_xref="CDD:32439"
FT                   /locus_tag="Alide_0306"
FT   misc_feature    complement(340002..340385)
FT                   /note="MOSC domain; Region: MOSC; pfam03473"
FT                   /db_xref="CDD:146227"
FT                   /locus_tag="Alide_0306"
FT   gene            complement(340517..341077)
FT                   /db_xref="GeneID:10102330"
FT                   /locus_tag="Alide_0307"
FT   CDS_pept        complement(340517..341077)
FT                   /locus_tag="Alide_0307"
FT                   /gene_family="HOG000223522" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /codon_start="1"
FT                   /product="alkyl hydroperoxide reductase/ thiol specific
FT                   antioxidant/ mal allergen"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: dia:Dtpsy_0211 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="GI:319761039"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="GeneID:10102330"
FT                   /protein_id="YP_004124976.1"
FT   misc_feature    complement(340655..341032)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Alide_0307"
FT   gene            complement(341096..341590)
FT                   /db_xref="GeneID:10102331"
FT                   /locus_tag="Alide_0308"
FT   CDS_pept        complement(341096..341590)
FT                   /locus_tag="Alide_0308"
FT                   /gene_family="HOG000225989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /codon_start="1"
FT                   /product="activator of hsp90 atpase 1 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: oca:OCAR_5014 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="GI:319761040"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="GeneID:10102331"
FT                   G"
FT                   /protein_id="YP_004124977.1"
FT   misc_feature    complement(341117..341572)
FT                   /note="Putative hydrophobic ligand-binding SRPBCC domain of
FT                   an uncharacterized subgroup of CalC- and Aha1-like
FT                   proteins; Region: SRPBCC_CalC_Aha1-like_6; cd08899"
FT                   /db_xref="CDD:176908"
FT                   /locus_tag="Alide_0308"
FT   misc_feature    complement(order(341186..341188,341195..341203,
FT                   341207..341233,341243..341245,341249..341251,
FT                   341255..341257,341261..341263,341291..341293,
FT                   341297..341299,341303..341308,341336..341341,
FT                   341345..341347,341363..341365,341372..341374,
FT                   341378..341383,341387..341389,341405..341407,
FT                   341411..341413,341417..341419,341423..341425,
FT                   341447..341449,341468..341470,341483..341488,
FT                   341492..341500,341525..341527,341531..341533,
FT                   341537..341539))
FT                   /note="putative hydrophobic ligand binding site; other
FT                   site"
FT                   /db_xref="CDD:176908"
FT                   /locus_tag="Alide_0308"
FT   gene            complement(341690..342151)
FT                   /db_xref="GeneID:10102332"
FT                   /locus_tag="Alide_0309"
FT   CDS_pept        complement(341690..342151)
FT                   /locus_tag="Alide_0309"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="maoc domain protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   dac:Daci_0013 dehydratase"
FT                   /db_xref="GI:319761041"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102332"
FT                   /protein_id="YP_004124978.1"
FT   misc_feature    complement(341726..342097)
FT                   /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
FT                   Catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway.  The structure
FT                   of the monomer includes a five-strand antiparallel...;
FT                   Region: R_hydratase_like; cd03441"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Alide_0309"
FT   misc_feature    complement(order(341954..341959,341966..341968,
FT                   342011..342013,342020..342022,342026..342028,
FT                   342041..342043))
FT                   /note="active site"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Alide_0309"
FT   misc_feature    complement(order(341957..341959,342011..342013,
FT                   342020..342022,342026..342028))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Alide_0309"
FT   gene            complement(342173..343144)
FT                   /db_xref="GeneID:10102333"
FT                   /locus_tag="Alide_0310"
FT   CDS_pept        complement(342173..343144)
FT                   /locus_tag="Alide_0310"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0012"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0012 hypothetical protein"
FT                   /db_xref="GI:319761042"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102333"
FT                   /protein_id="YP_004124979.1"
FT   sig_peptide     complement(343070..343144)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="Alide_0310"
FT   misc_feature    complement(342191..343003)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0310"
FT   gene            343298..344227
FT                   /db_xref="GeneID:10102334"
FT                   /locus_tag="Alide_0311"
FT   CDS_pept        343298..344227
FT                   /locus_tag="Alide_0311"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_0011 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319761043"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102334"
FT                   /protein_id="YP_004124980.1"
FT   misc_feature    343307..344167
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Alide_0311"
FT   misc_feature    343310..343486
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0311"
FT   misc_feature    343577..344164
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0311"
FT   misc_feature    order(343619..343624,343628..343633,343640..343642,
FT                   343652..343654,343658..343678,343952..343969,
FT                   343985..343990,343994..343999)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Alide_0311"
FT   gene            344352..345518
FT                   /db_xref="GeneID:10102335"
FT                   /locus_tag="Alide_0312"
FT   CDS_pept        344352..345518
FT                   /locus_tag="Alide_0312"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dac:Daci_0010 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319761044"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="GeneID:10102335"
FT                   /protein_id="YP_004124981.1"
FT   misc_feature    344391..345515
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:186184"
FT                   /locus_tag="Alide_0312"
FT   gene            complement(345536..346747)
FT                   /db_xref="GeneID:10102336"
FT                   /locus_tag="Alide_0313"
FT   CDS_pept        complement(345536..346747)
FT                   /locus_tag="Alide_0313"
FT                   /gene_family="HOG000269852" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="ATP-binding region atpase domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0212 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="GI:319761045"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:10102336"
FT                   PATR"
FT                   /protein_id="YP_004124982.1"
FT   misc_feature    complement(346178..>346288)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(346001..346180)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(order(346016..346018,346028..346030,
FT                   346037..346039,346049..346051,346058..346060,
FT                   346109..346111,346118..346120,346130..346132,
FT                   346139..346141,346151..346153,346163..346165))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(346145..346147)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(345551..345859)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(order(345563..345565,345569..345574,
FT                   345593..345595,345599..345601,345647..345658,
FT                   345734..345739,345743..345745,345749..345751,
FT                   345755..345757,345818..345820,345827..345829,
FT                   345839..345841))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(345827..345829)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0313"
FT   misc_feature    complement(order(345650..345652,345656..345658,
FT                   345737..345739,345743..345745))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Alide_0313"
FT   gene            complement(346757..347467)
FT                   /db_xref="GeneID:10102337"
FT                   /locus_tag="Alide_0314"
FT   CDS_pept        complement(346757..347467)
FT                   /locus_tag="Alide_0314"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="response regulator receiver"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0194 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="GI:319761046"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:10102337"
FT                   TVRGVGYVFAKQQD"
FT                   /protein_id="YP_004124983.1"
FT   misc_feature    complement(346772..347455)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(347135..347452)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(order(347144..347149,347156..347158,
FT                   347213..347215,347282..347284,347306..347308,
FT                   347438..347443))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(347306..347308)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(order(347282..347290,347294..347299))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(347141..347149)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(346775..347059)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Alide_0314"
FT   misc_feature    complement(order(346784..346786,346799..346801,
FT                   346835..346840,346862..346864,346871..346873,
FT                   346925..346930,346985..346987))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Alide_0314"
FT   gene            complement(347563..348921)
FT                   /db_xref="GeneID:10102338"
FT                   /locus_tag="Alide_0315"
FT   CDS_pept        complement(347563..348921)
FT                   /locus_tag="Alide_0315"
FT                   /gene_family="HOG000217209" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dia:Dtpsy_0214 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:319761047"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102338"
FT                   /protein_id="YP_004124984.1"
FT   misc_feature    complement(347710..348744)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cl11420"
FT                   /db_xref="CDD:187030"
FT                   /locus_tag="Alide_0315"
FT   gene            348931..349596
FT                   /db_xref="GeneID:10102339"
FT                   /locus_tag="Alide_0316"
FT   CDS_pept        348931..349596
FT                   /locus_tag="Alide_0316"
FT                   /gene_family="HOG000154776" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0215 transcriptional regulator, AraC
FT                   family; PFAM: Cupin 2 conserved barrel domain protein;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:319761048"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:10102339"
FT                   /protein_id="YP_004124985.1"
FT   misc_feature    <349012..349209
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Alide_0316"
FT   gene            349710..350603
FT                   /db_xref="GeneID:10102340"
FT                   /locus_tag="Alide_0317"
FT   CDS_pept        349710..350603
FT                   /locus_tag="Alide_0317"
FT                   /gene_family="HOG000253119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0201 hypothetical protein"
FT                   /db_xref="GI:319761049"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:10102340"
FT                   LLVIWSELRAAPKLGA"
FT                   /protein_id="YP_004124986.1"
FT   sig_peptide     349710..349793
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.490 at
FT                   residue 28"
FT                   /locus_tag="Alide_0317"
FT   gene            350600..351454
FT                   /db_xref="GeneID:10102341"
FT                   /locus_tag="Alide_0318"
FT   CDS_pept        350600..351454
FT                   /locus_tag="Alide_0318"
FT                   /gene_family="HOG000266075" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /codon_start="1"
FT                   /product="peptidase m48 ste24p"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ajs:Ajs_0203
FT                   peptidase M48, Ste24p"
FT                   /db_xref="GI:319761050"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="GeneID:10102341"
FT                   RGG"
FT                   /protein_id="YP_004124987.1"
FT   misc_feature    350756..351397
FT                   /note="Peptidase family M48; Region: Peptidase_M48;
FT                   cl12018"
FT                   /db_xref="CDD:187163"
FT                   /locus_tag="Alide_0318"
FT   gene            complement(351497..351727)
FT                   /db_xref="GeneID:10102342"
FT                   /locus_tag="Alide_0319"
FT                   /pseudo
FT   gene            351732..351941
FT                   /db_xref="GeneID:10102343"
FT                   /locus_tag="Alide_0320"
FT                   /pseudo
FT   gene            complement(352011..352766)
FT                   /db_xref="GeneID:10102344"
FT                   /locus_tag="Alide_0321"
FT   CDS_pept        complement(352011..352766)
FT                   /locus_tag="Alide_0321"
FT                   /gene_family="HOG000273992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="regulatory protein gntr hth"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0204 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:319761051"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:10102344"
FT                   /protein_id="YP_004124988.1"
FT   sig_peptide     complement(352710..352766)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.799 at
FT                   residue 19"
FT                   /locus_tag="Alide_0321"
FT   misc_feature    complement(352062..352736)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   GntR; COG1802"
FT                   /db_xref="CDD:31987"
FT                   /locus_tag="Alide_0321"
FT   misc_feature    complement(352515..352709)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Alide_0321"
FT   misc_feature    complement(order(352524..352535,352539..352544,
FT                   352572..352574,352581..352586,352590..352604,
FT                   352623..352628,352632..352634,352701..352703,
FT                   352707..352709))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Alide_0321"
FT   misc_feature    complement(352113..352490)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Alide_0321"
FT   gene            complement(352768..354474)
FT                   /db_xref="GeneID:10102345"
FT                   /locus_tag="Alide_0322"
FT   CDS_pept        complement(352768..354474)
FT                   /locus_tag="Alide_0322"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lch:Lcho_3364 sigma54 specific transcriptional
FT                   regulator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; Activator of aromatic
FT                   catabolism; 4-vinyl reductase 4VR; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="GI:319761052"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR020441"
FT                   /db_xref="GeneID:10102345"
FT                   /protein_id="YP_004124989.1"
FT   misc_feature    complement(354133..354441)
FT                   /note="Activator of aromatic catabolism; Region: XylR_N;
FT                   pfam06505"
FT                   /db_xref="CDD:115177"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(353920..354105)
FT                   /note="V4R domain; Region: V4R; cl08369"
FT                   /db_xref="CDD:158277"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(352801..353757)
FT                   /note="psp operon transcriptional activator PspF; Region:
FT                   phageshock_pspF; TIGR02974"
FT                   /db_xref="CDD:163093"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(353245..353742)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(353650..353673)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(order(353332..353334,353458..353460,
FT                   353647..353670))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(353455..353472)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0322"
FT   misc_feature    complement(353275..353277)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Alide_0322"
FT   gene            354706..355017
FT                   /db_xref="GeneID:10102346"
FT                   /locus_tag="Alide_0323"
FT   CDS_pept        354706..355017
FT                   /locus_tag="Alide_0323"
FT                   /gene_family="HOG000219895" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06099"
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase subunit; KEGG:
FT                   avn:Avin_30760 multi-component phenol hydoxylase, assembly
FT                   subunit; LapK"
FT                   /db_xref="GI:319761053"
FT                   /db_xref="InterPro:IPR010353"
FT                   /db_xref="GeneID:10102346"
FT                   /protein_id="YP_004124990.1"
FT   misc_feature    354748..354912
FT                   /note="Phenol hydroxylase subunit; Region: Phenol_hyd_sub;
FT                   pfam06099"
FT                   /db_xref="CDD:147972"
FT                   /locus_tag="Alide_0323"
FT   gene            355061..356053
FT                   /db_xref="GeneID:10102347"
FT                   /locus_tag="Alide_0324"
FT   CDS_pept        355061..356053
FT                   /locus_tag="Alide_0324"
FT                   /gene_family="HOG000219896" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo2443 phenol hydroxylase, subunit P1;
FT                   PFAM: methane/phenol/toluene hydroxylase"
FT                   /db_xref="GI:319761054"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="GeneID:10102347"
FT                   /product="phenol 2-monooxygenase"
FT                   /protein_id="YP_004124991.1"
FT   misc_feature    355118..355954
FT                   /note="Aromatic and Alkene Monooxygenase Hydroxylase,
FT                   subunit B, ferritin-like diiron-binding domain; Region:
FT                   AAMH_B; cd01058"
FT                   /db_xref="CDD:153116"
FT                   /locus_tag="Alide_0324"
FT   misc_feature    order(355319..355324,355331..355336,355340..355345,
FT                   355352..355357,355373..355378,355382..355384,
FT                   355739..355741,355751..355753,355760..355762,
FT                   355772..355774,355787..355789,355799..355801,
FT                   355808..355813,355817..355819,355826..355831,
FT                   355838..355840)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153116"
FT                   /locus_tag="Alide_0324"
FT   gene            356076..356345
FT                   /db_xref="GeneID:10102348"
FT                   /locus_tag="Alide_0325"
FT   CDS_pept        356076..356345
FT                   /locus_tag="Alide_0325"
FT                   /gene_family="HOG000219897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02406"
FT                   /codon_start="1"
FT                   /product="monooxygenase component mmob/dmpm"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   azo:azo2442 phenol hydrolase, subunit P2"
FT                   /db_xref="GI:319761055"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="GeneID:10102348"
FT                   /protein_id="YP_004124992.1"
FT   misc_feature    356076..356336
FT                   /note="MmoB/DmpM family; Region: MmoB_DmpM; pfam02406"
FT                   /db_xref="CDD:145512"
FT                   /locus_tag="Alide_0325"
FT   gene            356371..357918
FT                   /db_xref="GeneID:10102349"
FT                   /locus_tag="Alide_0326"
FT   CDS_pept        356371..357918
FT                   /locus_tag="Alide_0326"
FT                   /gene_family="HOG000219898" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02332"
FT                   /codon_start="1"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; YHS
FT                   domain-containing protein; KEGG: azo:azo2441 phenol
FT                   hydroxylase, subunit P3"
FT                   /db_xref="GI:319761056"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="GeneID:10102349"
FT                   /protein_id="YP_004124993.1"
FT   misc_feature    356425..357813
FT                   /note="Aromatic and Alkene Monooxygenase Hydroxylase,
FT                   subunit A, ferritin-like diiron-binding domain; Region:
FT                   AAMH_A; cd01057"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Alide_0326"
FT   misc_feature    order(356581..356586,356593..356598,356602..356607,
FT                   356617..356619,356635..356637,357031..357033,
FT                   357043..357045,357052..357054)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Alide_0326"
FT   misc_feature    order(356668..356670,356680..356685,356896..356898,
FT                   356989..356991,357199..357201,357208..357213,
FT                   357379..357381,357415..357417,357421..357423)
FT                   /note="putative path to active site cavity; other site"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Alide_0326"
FT   misc_feature    order(356695..356697,356785..356787,356794..356796,
FT                   356968..356970,357070..357072,357079..357081)
FT                   /note="diiron center; other site"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Alide_0326"
FT   gene            357985..358341
FT                   /db_xref="GeneID:10102350"
FT                   /locus_tag="Alide_0327"
FT   CDS_pept        357985..358341
FT                   /locus_tag="Alide_0327"
FT                   /gene_family="HOG000219899" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04663"
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase conserved region protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase conserved region; KEGG:
FT                   rpf:Rpic12D_3551 phenol hydroxylase conserved region"
FT                   /db_xref="GI:319761057"
FT                   /db_xref="InterPro:IPR006756"
FT                   /db_xref="GeneID:10102350"
FT                   FRTPGLTGLQGSCF"
FT                   /protein_id="YP_004124994.1"
FT   misc_feature    358024..358218
FT                   /note="Phenol hydroxylase conserved region; Region:
FT                   Phenol_monoox; pfam04663"
FT                   /db_xref="CDD:147023"
FT                   /locus_tag="Alide_0327"
FT   gene            358412..359482
FT                   /db_xref="GeneID:10102351"
FT                   /locus_tag="Alide_0328"
FT   CDS_pept        358412..359482
FT                   /locus_tag="Alide_0328"
FT                   /gene_family="HOG000263662" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /codon_start="1"
FT                   /product="oxidoreductase fad-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: azo:azo1850 phenol 2-monooxygenase"
FT                   /db_xref="GI:319761058"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="GeneID:10102351"
FT                   SAADAQQVRSPLFKKI"
FT                   /protein_id="YP_004124995.1"
FT   misc_feature    358412..359443
FT                   /note="CDP-6-deoxy-delta-3,4-glucoseen reductase;
FT                   Validated; Region: PRK07609"
FT                   /db_xref="CDD:181058"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    358421..358672
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(358508..358513,358520..358522,358529..358531,
FT                   358535..358546,358637..358642)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(358520..358522,358535..358537,358544..358546,
FT                   358640..358642)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    358709..359428
FT                   /note="Phenol 2-monooxygenase (phenol hydroxylase) is a
FT                   flavoprotein monooxygenase, able to use molecular oxygen as
FT                   a substrate in the microbial degredation of phenol. This
FT                   protein is encoded by a single gene and uses a tightly
FT                   bound FAD cofactor in the NAD(P); Region:
FT                   phenol_2-monooxygenase_like; cd06211"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(358823..358825,358859..358870,358910..358918,
FT                   358922..358924,358934..358942,359069..359071,
FT                   359078..359080,359420..359422,359426..359428)
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(358859..358861,358865..358870)
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(358931..358933,358940..358942,358949..358951,
FT                   358970..358972,358994..358996,359000..359002)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(359054..359056,359066..359077,359081..359083)
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Alide_0328"
FT   misc_feature    order(359069..359074,359147..359155,359345..359350)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Alide_0328"
FT   gene            359496..359837
FT                   /db_xref="GeneID:10102352"
FT                   /locus_tag="Alide_0329"
FT   CDS_pept        359496..359837
FT                   /locus_tag="Alide_0329"
FT                   /gene_family="HOG000219890" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /codon_start="1"
FT                   /product="ferredoxin"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; KEGG: ajs:Ajs_0217 ferredoxin"
FT                   /db_xref="GI:319761059"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="GeneID:10102352"
FT                   QAAPTLSTP"
FT                   /protein_id="YP_004124996.1"
FT   misc_feature    359508..359762
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Alide_0329"
FT   misc_feature    order(359598..359603,359610..359612,359619..359621,
FT                   359625..359636,359727..359732)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Alide_0329"
FT   misc_feature    order(359610..359612,359625..359627,359634..359636,
FT                   359730..359732)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Alide_0329"
FT   gene            359860..360786
FT                   /db_xref="GeneID:10102353"
FT                   /locus_tag="Alide_0330"
FT   CDS_pept        359860..360786
FT                   /locus_tag="Alide_0330"
FT                   /gene_family="HOG000219891" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03211"
FT                   /codon_start="1"
FT                   /product="catechol 2,3 dioxygenase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0218 catechol 2,3-dioxygenase;
FT                   TIGRFAM: catechol 2,3 dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:319761060"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0018577"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="GeneID:10102353"
FT                   /protein_id="YP_004124997.1"
FT   misc_feature    359872..360783
FT                   /note="catechol 2,3 dioxygenase; Region: catechol_2_3;
FT                   TIGR03211"
FT                   /db_xref="CDD:163184"
FT                   /locus_tag="Alide_0330"
FT   misc_feature    359872..360237
FT                   /note="N-terminal domain of catechol 2,3-dioxygenase;
FT                   Region: 2_3_CTD_N; cd07265"
FT                   /db_xref="CDD:176686"
FT                   /locus_tag="Alide_0330"
FT   misc_feature    order(359878..359883,360004..360006,360013..360015,
FT                   360073..360075,360235..360237)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176686"
FT                   /locus_tag="Alide_0330"
FT   misc_feature    360292..360717
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cl14632"
FT                   /db_xref="CDD:187396"
FT                   /locus_tag="Alide_0330"
FT   misc_feature    order(360316..360318,360328..360330,360427..360429,
FT                   360466..360468,360472..360474,360502..360504,
FT                   360625..360627,360649..360651,360655..360657)
FT                   /note="active site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Alide_0330"
FT   misc_feature    order(360316..360318,360502..360504,360655..360657)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Alide_0330"
FT   gene            360786..361217
FT                   /db_xref="GeneID:10102354"
FT                   /locus_tag="Alide_0331"
FT   CDS_pept        360786..361217
FT                   /locus_tag="Alide_0331"
FT                   /gene_family="HOG000195938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   ajs:Ajs_0219 hypothetical protein"
FT                   /db_xref="GI:319761061"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="GeneID:10102354"
FT                   /protein_id="YP_004124998.1"
FT   misc_feature    360867..361175
FT                   /note="Domain of unknown function (DUF336); Region: DUF336;
FT                   cl01249"
FT                   /db_xref="CDD:186401"
FT                   /locus_tag="Alide_0331"
FT   gene            complement(361218..361355)
FT                   /db_xref="GeneID:10102355"
FT                   /locus_tag="Alide_0332"
FT                   /pseudo
FT   gene            complement(361368..362457)
FT                   /db_xref="GeneID:10102356"
FT                   /locus_tag="Alide_0333"
FT                   /pseudo
FT   gene            362556..363461
FT                   /db_xref="GeneID:10102357"
FT                   /locus_tag="Alide_0334"
FT   CDS_pept        362556..363461
FT                   /locus_tag="Alide_0334"
FT                   /gene_family="HOG000116922" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3154"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_3154 ZorfX"
FT                   /db_xref="GI:319761062"
FT                   /db_xref="GeneID:10102357"
FT                   /protein_id="YP_004124999.1"
FT   sig_peptide     362556..362642
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 29"
FT                   /locus_tag="Alide_0334"
FT   misc_feature    362643..363458
FT                   /note="Protein involved in meta-pathway of phenol
FT                   degradation [Energy production and conversion]; Region:
FT                   COG4313"
FT                   /db_xref="CDD:34035"
FT                   /locus_tag="Alide_0334"
FT   gene            364232..365692
FT                   /db_xref="GeneID:10102358"
FT                   /locus_tag="Alide_0335"
FT   CDS_pept        364232..365692
FT                   /locus_tag="Alide_0335"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03216"
FT                   /codon_start="1"
FT                   /product="2-hydroxymuconic semialdehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0220 betaine-aldehyde dehydrogenase;
FT                   TIGRFAM: 2-hydroxymuconic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="GI:319761063"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="GeneID:10102358"
FT                   /protein_id="YP_004125000.1"
FT   misc_feature    364235..365677
FT                   /note="delta-1-pyrroline-5-carboxylate dehydrogenase, group
FT                   2, putative; Region: D1pyr5carbox2; TIGR01237"
FT                   /db_xref="CDD:130304"
FT                   /locus_tag="Alide_0335"
FT   misc_feature    364298..365683
FT                   /note="Human aldehyde dehydrogenase family 8 member
FT                   A1-like; Region: ALDH_F8_HMSADH; cd07093"
FT                   /db_xref="CDD:143412"
FT                   /locus_tag="Alide_0335"
FT   misc_feature    order(364685..364693,364709..364711,364763..364765,
FT                   364769..364774,364862..364864,364877..364882,
FT                   364922..364930,364937..364939,364946..364948,
FT                   364991..364996,365093..365095,365399..365401,
FT                   365405..365407,365597..365599)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:143412"
FT                   /locus_tag="Alide_0335"
FT   misc_feature    order(364694..364696,364991..364993,365084..365086,
FT                   365093..365095)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143412"
FT                   /locus_tag="Alide_0335"
FT   gene            365754..366617
FT                   /db_xref="GeneID:10102359"
FT                   /locus_tag="Alide_0336"
FT   CDS_pept        365754..366617
FT                   /locus_tag="Alide_0336"
FT                   /gene_family="HOG000028063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ctt:CtCNB1_3150 alpha/beta hydrolase fold protein"
FT                   /db_xref="GI:319761064"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102359"
FT                   PLPLAA"
FT                   /protein_id="YP_004125001.1"
FT   misc_feature    365808..366572
FT                   /note="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase;
FT                   Region: biphenyl_bphD; TIGR03343"
FT                   /db_xref="CDD:132386"
FT                   /locus_tag="Alide_0336"
FT   misc_feature    365928..366563
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Alide_0336"
FT   gene            366622..367404
FT                   /db_xref="GeneID:10102360"
FT                   /locus_tag="Alide_0337"
FT   CDS_pept        366622..367404
FT                   /locus_tag="Alide_0337"
FT                   /gene_family="HOG000179637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03220"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 2-oxopent-4-enoate hydratase; KEGG:
FT                   ajs:Ajs_0222 4-oxalocrotonate decarboxylase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:319761065"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR017632"
FT                   /db_xref="GeneID:10102360"
FT                   /product="2-oxopent-4-enoate hydratase"
FT                   /protein_id="YP_004125002.1"
FT   misc_feature    366634..367398
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:187031"
FT                   /locus_tag="Alide_0337"
FT   gene            367423..368337
FT                   /db_xref="GeneID:10102361"
FT                   /locus_tag="Alide_0338"
FT   CDS_pept        367423..368337
FT                   /locus_tag="Alide_0338"
FT                   /gene_family="HOG000052149" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03215"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetaldehyde dehydrogenase (acetylating);
FT                   KEGG: ajs:Ajs_0223 acetaldehyde dehydrogenase; PFAM:
FT                   Acetaldehyde dehydrogenase ; Semialdehyde dehydrogenase NAD
FT                   - binding"
FT                   /db_xref="GI:319761066"
FT                   /db_xref="GO:0008774"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="GeneID:10102361"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /protein_id="YP_004125003.1"
FT   misc_feature    367423..368250
FT                   /note="acetaldehyde dehydrogenase; Validated; Region:
FT                   PRK08300"
FT                   /db_xref="CDD:181366"
FT                   /locus_tag="Alide_0338"
FT   misc_feature    367438..367782
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0338"
FT   misc_feature    367813..368226
FT                   /note="Prokaryotic acetaldehyde dehydrogenase,
FT                   dimerization; Region: AcetDehyd-dimer; pfam09290"
FT                   /db_xref="CDD:150078"
FT                   /locus_tag="Alide_0338"
FT   gene            368352..369389
FT                   /db_xref="GeneID:10102362"
FT                   /locus_tag="Alide_0339"
FT   CDS_pept        368352..369389
FT                   /locus_tag="Alide_0339"
FT                   /gene_family="HOG000048047" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03217"
FT                   /codon_start="1"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0224 4-hydroxy-2-ketovalerate
FT                   aldolase; TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein"
FT                   /db_xref="GI:319761067"
FT                   /db_xref="GO:0008701"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="GeneID:10102362"
FT                   IKVAA"
FT                   /protein_id="YP_004125004.1"
FT   misc_feature    368364..369371
FT                   /note="4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid
FT                   aldolase,; Validated; Region: PRK08195"
FT                   /db_xref="CDD:181282"
FT                   /locus_tag="Alide_0339"
FT   misc_feature    368373..369164
FT                   /note="4-hydroxy-2-oxovalerate aldolase, N-terminal
FT                   catalytic TIM barrel domain; Region: DRE_TIM_HOA; cd07943"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Alide_0339"
FT   misc_feature    order(368397..368402,368409..368411,368490..368492,
FT                   368763..368765,368769..368771,368859..368861,
FT                   368946..368948,368952..368954)
FT                   /note="active site"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Alide_0339"
FT   misc_feature    order(368397..368402,368490..368492)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Alide_0339"
FT   misc_feature    order(368400..368402,368946..368948,368952..368954)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Alide_0339"
FT   misc_feature    369168..369365
FT                   /note="DmpG-like communication domain; Region: DmpG_comm;
FT                   pfam07836"
FT                   /db_xref="CDD:149094"
FT                   /locus_tag="Alide_0339"
FT   gene            369423..370211
FT                   /db_xref="GeneID:10102363"
FT                   /locus_tag="Alide_0340"
FT   CDS_pept        369423..370211
FT                   /locus_tag="Alide_0340"
FT                   /gene_family="HOG000179637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03218"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 4-oxalocrotonate decarboxylase; KEGG:
FT                   ajs:Ajs_0225 4-oxalocrotonate decarboxylase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:319761068"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR017630"
FT                   /db_xref="GeneID:10102363"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /protein_id="YP_004125005.1"
FT   misc_feature    369423..370205
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:187031"
FT                   /locus_tag="Alide_0340"
FT   gene            370252..371220
FT                   /db_xref="GeneID:10102364"
FT                   /locus_tag="Alide_0341"
FT   CDS_pept        370252..371220
FT                   /locus_tag="Alide_0341"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3145"
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_3145 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="GI:319761069"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:10102364"
FT                   /protein_id="YP_004125006.1"
FT   sig_peptide     370252..370314
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 21"
FT                   /locus_tag="Alide_0341"
FT   misc_feature    370381..371208
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0341"
FT   gene            371247..371438
FT                   /db_xref="GeneID:10102365"
FT                   /locus_tag="Alide_0342"
FT   CDS_pept        371247..371438
FT                   /locus_tag="Alide_0342"
FT                   /gene_family="HOG000077848" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /codon_start="1"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0227 4-oxalocrotonate tautomerase;
FT                   TIGRFAM: 4-oxalocrotonate tautomerase family enzyme; PFAM:
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="GI:319761070"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="GeneID:10102365"
FT                   VPKENWGIAGVSAKELGR"
FT                   /protein_id="YP_004125007.1"
FT   misc_feature    371250..371423
FT                   /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
FT                   isomerization of unsaturated ketones. The structure is a
FT                   homohexamer that is arranged as a trimer of dimers. The
FT                   hexamer contains six active sites, each formed by residues
FT                   from three monomers, two from one...; Region:
FT                   4Oxalocrotonate_Tautomerase; cd00491"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Alide_0342"
FT   misc_feature    order(371250..371255,371358..371360)
FT                   /note="active site 1"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Alide_0342"
FT   misc_feature    order(371250..371270,371304..371306,371313..371318,
FT                   371325..371327,371337..371342)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Alide_0342"
FT   misc_feature    order(371259..371261,371265..371267,371295..371300,
FT                   371307..371312,371319..371321,371352..371357,
FT                   371361..371375,371379..371384,371391..371417)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Alide_0342"
FT   misc_feature    order(371265..371267,371397..371399)
FT                   /note="active site 2"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Alide_0342"
FT   gene            complement(371503..372141)
FT                   /db_xref="GeneID:10102366"
FT                   /locus_tag="Alide_0343"
FT   CDS_pept        complement(371503..372141)
FT                   /locus_tag="Alide_0343"
FT                   /gene_family="HOG000058039" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0228"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0228 beta-lactamase domain-containing
FT                   protein"
FT                   /db_xref="GI:319761071"
FT                   /db_xref="GeneID:10102366"
FT                   /protein_id="YP_004125008.1"
FT   misc_feature    complement(371521..372141)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:186000"
FT                   /locus_tag="Alide_0343"
FT   gene            complement(372207..372959)
FT                   /db_xref="GeneID:10102367"
FT                   /locus_tag="Alide_0344"
FT   CDS_pept        complement(372207..372959)
FT                   /locus_tag="Alide_0344"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4281 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319761072"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102367"
FT                   /protein_id="YP_004125009.1"
FT   misc_feature    complement(372261..372911)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Alide_0344"
FT   misc_feature    complement(372654..372911)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0344"
FT   misc_feature    complement(372264..372572)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Alide_0344"
FT   gene            373084..374064
FT                   /db_xref="GeneID:10102368"
FT                   /locus_tag="Alide_0345"
FT   CDS_pept        373084..374064
FT                   /locus_tag="Alide_0345"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4280"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4280 hypothetical protein"
FT                   /db_xref="GI:319761073"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102368"
FT                   /protein_id="YP_004125010.1"
FT   sig_peptide     373084..373161
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.690 at
FT                   residue 26"
FT                   /locus_tag="Alide_0345"
FT   misc_feature    373228..374052
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0345"
FT   gene            374072..374944
FT                   /db_xref="GeneID:10102369"
FT                   /locus_tag="Alide_0346"
FT   CDS_pept        374072..374944
FT                   /locus_tag="Alide_0346"
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dac:Daci_4279
FT                   amidohydrolase 2"
FT                   /db_xref="GI:319761074"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102369"
FT                   QALYGFPPL"
FT                   /protein_id="YP_004125011.1"
FT   misc_feature    374111..374932
FT                   /note="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold [General function prediction only]; Region:
FT                   COG3618"
FT                   /db_xref="CDD:33417"
FT                   /locus_tag="Alide_0346"
FT   misc_feature    374132..374923
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:185881"
FT                   /locus_tag="Alide_0346"
FT   misc_feature    order(374147..374149,374153..374155,374501..374503,
FT                   374585..374587,374786..374788)
FT                   /note="active site"
FT                   /db_xref="CDD:30035"
FT                   /locus_tag="Alide_0346"
FT   gene            374967..375956
FT                   /db_xref="GeneID:10102370"
FT                   /locus_tag="Alide_0347"
FT   CDS_pept        374967..375956
FT                   /locus_tag="Alide_0347"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4278 hypothetical protein"
FT                   /db_xref="GI:319761075"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102370"
FT                   /protein_id="YP_004125012.1"
FT   sig_peptide     374967..375053
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT                   /locus_tag="Alide_0347"
FT   misc_feature    375123..375944
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0347"
FT   gene            375989..376675
FT                   /db_xref="GeneID:10102371"
FT                   /locus_tag="Alide_0348"
FT   CDS_pept        375989..376675
FT                   /locus_tag="Alide_0348"
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /codon_start="1"
FT                   /product="dimethylmenaquinone methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   dac:Daci_4277 dimethylmenaquinone methyltransferase"
FT                   /db_xref="GI:319761076"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="GeneID:10102371"
FT                   KEGEEL"
FT                   /protein_id="YP_004125013.1"
FT   misc_feature    376007..376648
FT                   /note="hypothetical protein; Validated; Region: PRK06201"
FT                   /db_xref="CDD:180465"
FT                   /locus_tag="Alide_0348"
FT   misc_feature    376007..376561
FT                   /note="Demethylmenaquinone methyltransferase; Region:
FT                   Methyltransf_6; cl00480"
FT                   /db_xref="CDD:186024"
FT                   /locus_tag="Alide_0348"
FT   gene            376672..377589
FT                   /db_xref="GeneID:10102372"
FT                   /locus_tag="Alide_0349"
FT   CDS_pept        376672..377589
FT                   /locus_tag="Alide_0349"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /codon_start="1"
FT                   /product="d-isomer specific 2-hydroxyacid dehydrogenase
FT                   nad-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: vap:Vapar_5586 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761077"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="GeneID:10102372"
FT                   /protein_id="YP_004125014.1"
FT   misc_feature    376678..377583
FT                   /note="Lactate dehydrogenase and related dehydrogenases
FT                   [Energy production and conversion / Coenzyme metabolism /
FT                   General function prediction only]; Region: LdhA; COG1052"
FT                   /db_xref="CDD:31252"
FT                   /locus_tag="Alide_0349"
FT   misc_feature    377026..377514
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0349"
FT   gene            377614..378603
FT                   /db_xref="GeneID:10102373"
FT                   /locus_tag="Alide_0350"
FT   CDS_pept        377614..378603
FT                   /locus_tag="Alide_0350"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Vapar_3894"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_3894 hypothetical protein"
FT                   /db_xref="GI:319761078"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102373"
FT                   /protein_id="YP_004125015.1"
FT   sig_peptide     377614..377706
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT                   /locus_tag="Alide_0350"
FT   misc_feature    377773..378591
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0350"
FT   gene            378950..379906
FT                   /db_xref="GeneID:10102374"
FT                   /locus_tag="Alide_0351"
FT   CDS_pept        378950..379906
FT                   /locus_tag="Alide_0351"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4274"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4274 hypothetical protein"
FT                   /db_xref="GI:319761079"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102374"
FT                   /protein_id="YP_004125016.1"
FT   sig_peptide     378950..379015
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT                   /locus_tag="Alide_0351"
FT   misc_feature    379076..379885
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0351"
FT   gene            379912..380787
FT                   /db_xref="GeneID:10102375"
FT                   /locus_tag="Alide_0352"
FT   CDS_pept        379912..380787
FT                   /locus_tag="Alide_0352"
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dac:Daci_4273
FT                   amidohydrolase 2"
FT                   /db_xref="GI:319761080"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102375"
FT                   VDNPARLYGF"
FT                   /protein_id="YP_004125017.1"
FT   misc_feature    379966..380784
FT                   /note="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold [General function prediction only]; Region:
FT                   COG3618"
FT                   /db_xref="CDD:33417"
FT                   /locus_tag="Alide_0352"
FT   misc_feature    379987..380775
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:185881"
FT                   /locus_tag="Alide_0352"
FT   misc_feature    order(380002..380004,380008..380010,380368..380370,
FT                   380452..380454,380650..380652)
FT                   /note="active site"
FT                   /db_xref="CDD:30035"
FT                   /locus_tag="Alide_0352"
FT   gene            380800..381717
FT                   /db_xref="GeneID:10102376"
FT                   /locus_tag="Alide_0353"
FT   CDS_pept        380800..381717
FT                   /locus_tag="Alide_0353"
FT                   /gene_family="HOG000219379" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /codon_start="1"
FT                   /product="smp-30/gluconolaconase/lre-like region-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: dac:Daci_4272
FT                   SMP-30/gluconolaconase/LRE domain-containing protein"
FT                   /db_xref="GI:319761081"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="GeneID:10102376"
FT                   /protein_id="YP_004125018.1"
FT   misc_feature    380932..381645
FT                   /note="SMP-30/Gluconolaconase/LRE-like region; Region: SGL;
FT                   pfam08450"
FT                   /db_xref="CDD:149490"
FT                   /locus_tag="Alide_0353"
FT   misc_feature    381196..>381351
FT                   /note="Strictosidine synthase; Region: Str_synth;
FT                   pfam03088"
FT                   /db_xref="CDD:111929"
FT                   /locus_tag="Alide_0353"
FT   gene            complement(381729..382712)
FT                   /db_xref="GeneID:10102377"
FT                   /locus_tag="Alide_0354"
FT   CDS_pept        complement(381729..382712)
FT                   /locus_tag="Alide_0354"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_4433"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4433 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319761082"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:10102377"
FT                   /protein_id="YP_004125019.1"
FT   sig_peptide     complement(382632..382712)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 27"
FT                   /locus_tag="Alide_0354"
FT   misc_feature    complement(381741..382562)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Alide_0354"
FT   gene            complement(382731..383624)
FT                   /db_xref="GeneID:10102378"
FT                   /locus_tag="Alide_0355"
FT   CDS_pept        complement(382731..383624)
FT                   /locus_tag="Alide_0355"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:"
FT                   /codon_start="1"
FT                   /EC_number=""
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_2089 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761083"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102378"
FT                   GEKYHPVISRLIAGQR"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /protein_id="YP_004125020.1"
FT   misc_feature    complement(382743..383600)
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Alide_0355"
FT   misc_feature    complement(<383076..383600)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0355"
FT   gene            complement(383647..385098)
FT                   /db_xref="GeneID:10102379"
FT                   /locus_tag="Alide_0356"
FT   CDS_pept        complement(383647..385098)
FT                   /locus_tag="Alide_0356"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: vei:Veis_2088
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="GI:319761084"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="GeneID:10102379"
FT                   /protein_id="YP_004125021.1"
FT   misc_feature    complement(383665..385092)
FT                   /note="delta-1-pyrroline-5-carboxylate dehydrogenase, group
FT                   2, putative; Region: D1pyr5carbox2; TIGR01237"
FT                   /db_xref="CDD:130304"
FT                   /locus_tag="Alide_0356"
FT   misc_feature    complement(383659..385026)
FT                   /note="Uncharacterized Candidatus pelagibacter aldehyde
FT                   dehydrogenase, DhaS-like; Region: ALDH_DhaS; cd07114"
FT                   /db_xref="CDD:143432"
FT                   /locus_tag="Alide_0356"
FT   misc_feature    complement(order(383743..383745,383857..383859,
FT                   383935..383937,383941..383943,384244..384246,
FT                   384340..384348,384388..384393,384400..384402,
FT                   384409..384420,384562..384567,384571..384573,
FT                   384616..384618,384640..384654))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143432"
FT                   /locus_tag="Alide_0356"
FT   misc_feature    complement(order(384244..384246,384253..384255,
FT                   384346..384348,384640..384642))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143432"
FT                   /locus_tag="Alide_0356"
FT   gene            complement(385293..386021)
FT                   /db_xref="GeneID:10102380"
FT                   /locus_tag="Alide_0357"
FT   CDS_pept        complement(385293..386021)
FT                   /locus_tag="Alide_0357"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4432 IclR family transcriptional
FT                   regulator family; PFAM: regulatory protein IclR;
FT                   Transcriptional regulator IclR; SMART: regulatory protein
FT                   IclR"
FT                   /db_xref="GI:319761085"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102380"
FT                   /protein_id="YP_004125022.1"
FT   misc_feature    complement(385713..385976)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Alide_0357"
FT   misc_feature    complement(385314..385970)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Alide_0357"
FT   misc_feature    complement(385338..>385466)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Alide_0357"
FT   gene            386294..386698
FT                   /db_xref="GeneID:10102381"
FT                   /locus_tag="Alide_0358"
FT   CDS_pept        386294..386698
FT                   /locus_tag="Alide_0358"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tcur_0017"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tcu:Tcur_0017 hypothetical protein"
FT                   /db_xref="GI:319761086"
FT                   /db_xref="GeneID:10102381"
FT                   /protein_id="YP_004125023.1"
FT   gene            386719..387567
FT                   /db_xref="GeneID:10102382"
FT                   /locus_tag="Alide_0359"
FT   CDS_pept        386719..387567
FT                   /locus_tag="Alide_0359"
FT                   /gene_family="HOG000076805" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   msm:MSMEG_2534 carboxylesterase protein"
FT                   /db_xref="GI:319761087"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102382"
FT                   R"
FT                   /protein_id="YP_004125024.1"
FT   misc_feature    386755..387555
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Alide_0359"
FT   misc_feature    386899..387537
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Alide_0359"
FT   gene            387622..388776
FT                   /db_xref="GeneID:10102383"
FT                   /locus_tag="Alide_0360"
FT   CDS_pept        387622..388776
FT                   /locus_tag="Alide_0360"
FT                   /gene_family="HOG000128115" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bav:BAV0983 ABC transporter, substrate-binding protein"
FT                   /db_xref="GI:319761088"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:10102383"
FT                   /protein_id="YP_004125025.1"
FT   sig_peptide     387622..387678
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 19"
FT                   /locus_tag="Alide_0360"
FT   misc_feature    387664..388731
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Alide_0360"
FT   misc_feature    387688..388713
FT                   /note="Type 1 periplasmic binding fold superfamily; Region:
FT                   Periplasmic_Binding_Protein_Type_1; cl10011"
FT                   /db_xref="CDD:186883"
FT                   /locus_tag="Alide_0360"
FT   gene            388798..389667
FT                   /db_xref="GeneID:10102384"
FT                   /locus_tag="Alide_0361"
FT   CDS_pept        388798..389667
FT                   /locus_tag="Alide_0361"
FT                   /gene_family="HOG000202530" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bav:BAV0982
FT                   ABC transporter, permease protein"
FT                   /db_xref="GI:319761089"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102384"
FT                   GLLGKSGR"
FT                   /protein_id="YP_004125026.1"
FT   misc_feature    388837..389649
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivH
FT                   and related proteins. LivH is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivH_like;
FT                   cd06582"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Alide_0361"
FT   misc_feature    389326..389382
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Alide_0361"
FT   gene            389672..390670
FT                   /db_xref="GeneID:10102385"
FT                   /locus_tag="Alide_0362"
FT   CDS_pept        389672..390670
FT                   /locus_tag="Alide_0362"
FT                   /gene_family="HOG000202417" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dma:DMR_11370 ABC transporter permease protein"
FT                   /db_xref="GI:319761090"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102385"
FT                   /protein_id="YP_004125027.1"
FT   misc_feature    389834..390631
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivM
FT                   and related proteins. LivM is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivM_like;
FT                   cd06581"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Alide_0362"
FT   misc_feature    390305..390361
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Alide_0362"
FT   gene            390667..391446
FT                   /db_xref="GeneID:10102386"
FT                   /locus_tag="Alide_0363"
FT   CDS_pept        390667..391446
FT                   /locus_tag="Alide_0363"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_2348 ABC-type branched-chain amino
FT                   acid transport systems, ATPase component; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319761091"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:10102386"
FT                   /protein_id="YP_004125028.1"
FT   misc_feature    390667..391425
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivG; COG0411"
FT                   /db_xref="CDD:30760"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    390679..391404
FT                   /note="The Mj1267/LivG ABC transporter subfamily is
FT                   involved in the transport of the hydrophobic amino acids
FT                   leucine, isoleucine and valine.  MJ1267 is a branched-chain
FT                   amino acid transporter with 29% similarity to both the LivF
FT                   and LivG components of the E...; Region:
FT                   ABC_Mj1267_LivG_branched; cd03219"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    390775..390798
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    order(390784..390789,390793..390801,390922..390924,
FT                   391195..391200,391297..391299)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    390913..390924
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    391123..391152
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    391183..391200
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    391207..391218
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   misc_feature    391285..391305
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Alide_0363"
FT   gene            391433..392146
FT                   /db_xref="GeneID:10102387"
FT                   /locus_tag="Alide_0364"
FT   CDS_pept        391433..392146
FT                   /locus_tag="Alide_0364"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: oan:Oant_4420 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319761092"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:10102387"
FT                   ELLRDAFVQKAFLGV"
FT                   /protein_id="YP_004125029.1"
FT   misc_feature    391433..392143
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivF; COG0410"
FT                   /db_xref="CDD:30759"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    391445..392113
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    391538..391561
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    order(391547..391552,391556..391564,391685..391687,
FT                   391913..391918,392015..392017)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    391676..391687
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    391841..391870
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    391901..391918
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    391925..391936
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   misc_feature    392003..392023
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Alide_0364"
FT   gene            392149..393171
FT                   /db_xref="GeneID:10102388"
FT                   /locus_tag="Alide_0365"
FT   CDS_pept        392149..393171
FT                   /locus_tag="Alide_0365"
FT                   /gene_family="HOG000217475" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bbr:BB2353
FT                   hypothetical protein"
FT                   /db_xref="GI:319761093"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102388"
FT                   "
FT                   /protein_id="YP_004125030.1"
FT   misc_feature    392221..393168
FT                   /note="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold [General function prediction only]; Region:
FT                   COG3618"
FT                   /db_xref="CDD:33417"
FT                   /locus_tag="Alide_0365"
FT   misc_feature    392242..393165
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:185881"
FT                   /locus_tag="Alide_0365"
FT   gene            complement(393156..393887)
FT                   /db_xref="GeneID:10102389"
FT                   /locus_tag="Alide_0366"
FT   CDS_pept        complement(393156..393887)
FT                   /locus_tag="Alide_0366"
FT                   /gene_family="HOG000229497" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="regulatory protein gntr hth"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0229 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:319761094"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:10102389"
FT                   /protein_id="YP_004125031.1"
FT   misc_feature    complement(393177..393845)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   GntR; COG1802"
FT                   /db_xref="CDD:31987"
FT                   /locus_tag="Alide_0366"
FT   misc_feature    complement(393615..393773)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Alide_0366"
FT   misc_feature    complement(order(393615..393626,393630..393635,
FT                   393663..393665,393672..393677,393681..393695,
FT                   393717..393722,393723..393725))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Alide_0366"
FT   gene            393971..395173
FT                   /db_xref="GeneID:10102390"
FT                   /locus_tag="Alide_0367"
FT   CDS_pept        393971..395173
FT                   /locus_tag="Alide_0367"
FT                   /gene_family="HOG000131660" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0230 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319761095"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102390"
FT                   A"
FT                   /protein_id="YP_004125032.1"
FT   misc_feature    393971..395125
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Alide_0367"
FT   misc_feature    393989..395110
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Alide_0367"
FT   misc_feature    order(394265..394267,394355..394357,394361..394363,
FT                   394460..394462,394466..394468,395066..395074,
FT                   395078..395080,395084..395086)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Alide_0367"
FT   gene            395170..395943
FT                   /db_xref="GeneID:10102391"
FT                   /locus_tag="Alide_0368"
FT   CDS_pept        395170..395943
FT                   /locus_tag="Alide_0368"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dia:Dtpsy_0225 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319761096"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102391"
FT                   /protein_id="YP_004125033.1"
FT   sig_peptide     395170..395271
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.738 at
FT                   residue 34"
FT                   /locus_tag="Alide_0368"
FT   misc_feature    395194..395922
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Alide_0368"
FT   misc_feature    395197..395916
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Alide_0368"
FT   gene            395940..396980
FT                   /db_xref="GeneID:10102392"
FT                   /locus_tag="Alide_0369"
FT   CDS_pept        395940..396980
FT                   /locus_tag="Alide_0369"
FT                   /gene_family="HOG000131666" [ FAMILY / ALN /