(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE10

ALDEN1_2.PE10        Location/Qualifiers
FT   CDS_pept        complement(11853..13865)
FT                   /locus_tag="Alide_0010"
FT                   /gene_family="HOG000008989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /codon_start="1"
FT                   /product="carbamoyl-phosphate synthase l chain ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   reh:H16_A2142 acetyl-CoA carboxylase alpha chain"
FT                   /db_xref="GI:319760748"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:10102033"
FT                   /translation="MRFDTLLVANRGEIALRILRTARRMGLRTVAVYSDADAHGPHVRA
FT                   ADMAVHIGPTPADQSYRNGAALIEACRRTGAQAIHPGYGFLSENAEFAQAVADAGLVFV
FT                   GPSARVIALMGNKAQAKQAMQAAGVPTVPGEQGCATQEQIAAAARRIGFPVILKAAAGG
FT                   GGRGMRVVREAGDLAEMFRQAQSEAAGAFGSGEIIIERAIERGRHIEVQVLCDEHGRCL
FT                   HLGERDCSTQRRFQKLIEEAPSPAVDAALREAMGQVARQACEAIGYTGVGTLEFLLDDQ
FT                   KRFYFMEMNTRLQVEHGVTELVTGLDLVEQQIRVAQGEALTFGQQDVRLKGHAIELRLC
FT                   AEDPWAGFLPQVGTVGEWQAPAGIRTDSALASGMAISPFYDSMVAKLMAWGESREACIA
FT                   QLARACERTTALGVRTNLGFLARCLRHPRFAQGQVTTDFLAQEDLQQPFWRRAPSAHAL
FT                   AAAALVLGGAVKTAMAGPAERLGGRSLWLRDATAGGTTMQCTLARDAAGLVLHCGERAP
FT                   GKAAVEDAQASSWQIAHLRWHDEAGGARLGLAIEGIYRELACWQEAAGRLWVQDGADAF
FT                   VFERVERFEAAGARQGSGLLRAPMSGRVIAVLAGEGQSVAQGDPLVVIESMKMEMPLAA
FT                   PCAGRIARLHVGEGQQLDAGQAVLEVDSEEEKETP"
FT                   /protein_id="YP_004124685.1"
     atgcgtttcg acacgctgct cgtggccaac cggggcgaga tcgccctgcg catcctgcgc        60
     accgcgcggc gcatgggcct gcgcacggtg gccgtgtatt ccgacgccga cgcgcacggc       120
     ccgcacgtgc gcgcggcgga catggccgtg cacataggcc ccacgccggc cgaccagagc       180
     taccgcaacg gcgccgcgct gatcgaggcc tgccgccgca ccggcgccca ggccatccac       240
     ccgggctacg gcttcctgtc ggagaacgcc gagttcgcgc aggccgtggc cgatgcgggc       300
     ctggtcttcg tcggcccctc ggcgcgggtg atcgcgctga tgggcaacaa ggcccaggcc       360
     aagcaggcca tgcaggccgc gggcgtgccc acggtgccgg gcgagcaggg ttgcgccacg       420
     caggagcaga tcgccgcggc ggcgcggcgc atcggctttc cggtcatcct caaggccgcg       480
     gccggtggcg gcgggcgcgg catgcgcgtg gtgcgcgagg cgggcgacct ggccgagatg       540
     ttccgccagg cgcagtccga ggcggcgggc gccttcggct ccggcgagat catcatcgag       600
     cgcgccatcg agcgcggccg ccacatcgag gtgcaggtgc tgtgcgacga gcacggccgc       660
     tgcctgcacc tgggcgagcg tgactgctcc acgcagcggc gcttccagaa gttgatcgag       720
     gaggcgccct cgcccgcggt ggacgccgcg ctgcgcgagg ccatgggcca ggtggcgcgc       780
     caggcctgcg aggccatcgg ctacaccggc gtgggcacgc tggagtttct gctcgacgac       840
     cagaagcgct tctacttcat ggagatgaac acccgcctgc aggtggagca cggcgtgacc       900
     gagctggtca cggggctgga cctggtggag cagcagatcc gcgtggccca gggcgaggcc       960
     ctgaccttcg gccagcagga cgtacggctc aagggccacg cgatcgagct gcgcctgtgc      1020
     gccgaagacc cctgggccgg atttttgccg caggtgggca ccgtgggcga gtggcaagcg      1080
     cccgccggca tccgcaccga cagcgcgctg gcgagcggca tggcgatcag cccgttctac      1140
     gactcgatgg tcgccaagct catggcctgg ggcgagagcc gtgaggcctg catcgcccag      1200
     ctggcgcgcg cctgcgagcg caccacggcg ctgggcgtgc gcaccaacct ggggttcctg      1260
     gcgcgctgcc tgcggcaccc gcgcttcgcg caaggccagg tgaccacgga cttcctggcg      1320
     caagaggacc tgcagcagcc gttctggcgg cgcgcgccct cggcgcacgc gctggccgcg      1380
     gctgcgctgg tgctgggcgg cgcggtgaag accgccatgg ccgggccggc agagcgcctg      1440
     ggcgggcgct cgctgtggct gcgcgacgcc accgctggcg gtacgaccat gcaatgcacc      1500
     ctagcgcgcg acgctgcggg cttggtgctg cactgtggcg agcgtgcgcc gggcaaggca      1560
     gcagtcgagg atgcgcaggc atccagttgg cagatagccc atctgcgctg gcacgacgag      1620
     gcaggcggcg cccgcctggg gctggccatc gaaggcatct accgcgagct ggcgtgctgg      1680
     caggaggccg caggccggct gtgggtgcag gacggcgccg acgccttcgt cttcgagcgc      1740
     gtcgagcgct tcgaggccgc cggcgcccgg cagggcagcg gcctgctgcg cgcgcccatg      1800
     agcggccgcg tgatcgcggt gctcgcaggc gaggggcaga gcgtggcgca gggcgatccg      1860
     ctggtcgtca tcgaatccat gaagatggaa atgccgctgg ccgcgccctg cgcgggccgc      1920
     atcgcgcggc tgcacgtggg cgagggccag cagctcgacg ccggccaggc cgtcctggaa      1980
     gtggacagtg aagaggagaa ggagacgcca tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page