(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE101

ALDEN1_2.PE101       Location/Qualifiers
FT   CDS_pept        complement(109535..110473)
FT                   /locus_tag="Alide_0102"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pna:Pnap_1015 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760839"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102125"
FT                   /translation="MQELGNASSEMAFFHLLVRCGSLSATARELGLTTPAVSRKLALLE
FT                   QRLGVQLLNRTTRRNSLTPEGEEYLVQARRILADIEDVEHSLRRSMAEPLGLLRVNATL
FT                   GFGRSHIAPVISRFCKTYPQVQIQFHLSVTPPPLTDDAFDVCIRFGEPPDARVIARKVA
FT                   ANRRLLCAAPAYLERHGTPRVPADLVRHQCISIHHGQDAYGIWRLSAGRRTESVKVAET
FT                   MVTNDGDIAVAWALDGHGILMRAEWDIDKYLHSGRLRQVLEQYSTPPADIYAVYPSRHQ
FT                   KARRVTAFVDFLCAELGQATSKTQASPRHRR"
FT                   /protein_id="YP_004124776.1"
     atgcaggaac tcggcaacgc ttcgtcggag atggcgttct tccatctgct ggtgcgctgc        60
     ggcagcctgt ccgccaccgc acgcgaattg gggctgacca cgccggcggt gagccgcaag       120
     cttgccctgc tggagcagcg gctgggcgtt caattgctca accgcaccac ccgccgcaac       180
     tcgctcacgc ccgaaggcga ggagtacctg gtgcaagcgc ggcgcatcct ggcggacatc       240
     gaagacgtgg agcacagcct gcgccgctcg atggccgaac cgctcggcct gctgcgcgtg       300
     aacgcgacgc tgggtttcgg gcgcagccac atcgcaccgg tgatctcgcg cttttgcaag       360
     acctatccgc aggtgcagat ccagttccac ctgtcggtca cgccgccgcc gctgacggac       420
     gatgccttcg acgtctgcat ccgctttggc gagccgccgg acgcgcgcgt gatcgcccgc       480
     aaggtggcgg ccaaccggcg tctgctgtgc gcggcccccg catacctgga gcgccatggc       540
     acgccgcgcg tgccggccga cctggtgcgc caccaatgca tcagcatcca ccacggccag       600
     gacgcctacg gcatctggcg cctgagcgcc gggcggcgca cggagtcggt caaggtggcg       660
     gaaacgatgg tgaccaatga cggcgacatc gccgtggcgt gggcgctgga cggccacggc       720
     atcctgatgc gcgcggaatg ggacatcgac aaatacctgc acagcgggcg gctgcgccag       780
     gtgctggagc agtattcgac gcctcccgcc gacatctatg ccgtctaccc ctcccggcac       840
     cagaaggcgc ggcgcgtcac cgccttcgtc gatttcctgt gcgccgaact cggccaggcc       900
     acgtccaaga cccaggcctc gcctcgccac cggcgctag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page