(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE102

ALDEN1_2.PE102       Location/Qualifiers
FT   CDS_pept        110587..111564
FT                   /locus_tag="Alide_0103"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bpro_4513"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_4513 hypothetical protein"
FT                   /db_xref="GI:319760840"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102126"
FT                   /translation="MSHEILRLSRRSTILGLSLLPLAGYAQAYPAKPVSVVIPYSAGGT
FT                   TDIVARLIAQSLAASTGKTFVAENKGGGSTTIATGAVAKAAPDGYTLLANEMTQTIIPW
FT                   LFPKLSFDPIKDLLPVTVFAEAPYVLVVNSGVPAKSLRELVDLAKAQPGKLNFASGGAG
FT                   SGPHIAGELLKTVAGVDMTHVPYKGSGPAVADLLGGQVDVLITAAPTVTAQMGSGRMRP
FT                   LAVAHPRRLSSLPDVPTAAEAGFPDFRIANWFGLAAPKGTPAEVVAYLHAEVQKVLQRA
FT                   DVRDKLLAAGAEPVSMTPAEAARHVNAEARRWGELVRKAQIRLD"
FT                   /protein_id="YP_004124777.1"
     GTGAGCCATG AAATCCTGCG GCTGTCGCGC AGATCCACCA TCCTCGGGCT GAGCCTCCTG        60
     CCATTGGCAG GGTATGCGCA GGCCTATCCC GCCAAACCGG TCAGCGTGGT GATTCCCTAT       120
     TCCGCCGGGG GGACCACGGA CATCGTCGCG CGGCTGATCG CGCAGTCGCT GGCCGCCAGC       180
     ACGGGCAAGA CCTTCGTGGC CGAGAACAAG GGCGGCGGCA GCACCACCAT CGCCACGGGC       240
     GCCGTGGCCA AGGCCGCACC GGACGGCTAC ACCCTGCTGG CCAACGAGAT GACGCAGACC       300
     ATCATCCCGT GGCTGTTCCC CAAGCTGTCT TTCGATCCGA TCAAGGATCT GCTGCCCGTC       360
     ACGGTGTTCG CCGAGGCGCC CTATGTGCTC GTCGTCAATT CCGGCGTGCC GGCCAAGAGC       420
     CTGCGCGAGC TGGTGGATCT GGCGAAGGCG CAGCCGGGCA AGCTCAACTT CGCCTCGGGC       480
     GGCGCCGGCA GCGGCCCGCA CATCGCCGGT GAACTGCTCA AGACCGTCGC GGGTGTGGAC       540
     ATGACCCACG TGCCCTACAA GGGCTCGGGC CCCGCCGTGG CCGATCTTCT GGGCGGGCAG       600
     GTGGACGTGC TCATCACCGC GGCGCCCACG GTGACCGCGC AGATGGGATC GGGCCGCATG       660
     CGCCCGCTGG CGGTGGCGCA CCCGCGGCGC CTGTCCTCGC TGCCCGACGT GCCGACGGCA       720
     GCGGAGGCCG GGTTTCCCGA TTTCCGCATC GCCAACTGGT TCGGGCTGGC CGCGCCCAAG       780
     GGCACGCCGG CCGAGGTCGT CGCCTATCTG CACGCGGAGG TGCAGAAGGT GCTTCAAAGA       840
     GCCGACGTGC GCGACAAGCT CCTGGCCGCC GGCGCCGAGC CCGTGTCGAT GACGCCGGCC       900
     GAGGCCGCGC GCCACGTGAA TGCCGAAGCG CGCCGCTGGG GCGAACTGGT GCGCAAGGCG       960
     CAGATCCGGC TGGACTGA                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page