(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE103

ALDEN1_2.PE103       Location/Qualifiers
FT   CDS_pept        111592..112755
FT                   /locus_tag="Alide_0104"
FT                   /gene_family="HOG000113756" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /codon_start="1"
FT                   /product="mandelate racemase/muconate lactonizing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: mes:Meso_4537 galactonate dehydratase"
FT                   /db_xref="GI:319760841"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="GeneID:10102127"
FT                   /translation="MKIRKVEPLHVGQFMFVRITTDDGTVGYGEAGTWGHIEAAGVCIR
FT                   RFAEYLEGKDAFAIEHHWNVMHRFSYFTGLAENAAISAIDIALWDIKGKALNVPIYELL
FT                   GGAARTKARIYGHIYEHSIEKMLVECQAKMEAGFNAFGHLNPFLDEGNDQIYFKTHIKK
FT                   MRDAIDNTRRMREVVGDRVDLLIEIHRRLTPAEAIVFARGIEDTHPMFIEDPIRPEGPD
FT                   GMARVAEKIGIPIATGERFANLYEFQTLMARGGVEYARVDLCLCGGITGAKKVAAIAEA
FT                   HHVQVVPHNPLSPIGLAACLQLDAAIPNFAIQEYATGFEAGIFESRPEHLGSDIVDQVP
FT                   LPDAGFVDIPTGPGLGMNLLPDAQKIRPPLVKPISMRPHFDGFVVDQ"
FT                   /protein_id="YP_004124778.1"
     ATGAAGATTC GCAAGGTGGA GCCCCTGCAC GTGGGGCAAT TCATGTTCGT TCGCATCACC        60
     ACGGACGACG GTACCGTGGG CTATGGCGAG GCGGGCACCT GGGGCCATAT CGAGGCGGCG       120
     GGCGTTTGCA TCCGCCGCTT CGCGGAGTAC CTGGAAGGCA AGGACGCCTT CGCCATCGAG       180
     CACCACTGGA ACGTGATGCA TCGCTTCAGC TATTTCACGG GCCTGGCGGA AAACGCCGCC       240
     ATCTCGGCCA TCGACATCGC CCTGTGGGAC ATCAAGGGCA AGGCGCTCAA CGTGCCCATC       300
     TACGAACTGC TGGGCGGTGC CGCGCGCACC AAGGCGCGCA TCTACGGCCA CATCTACGAG       360
     CACAGCATCG AGAAGATGCT CGTGGAGTGC CAGGCCAAGA TGGAGGCGGG CTTCAACGCA       420
     TTCGGCCACC TCAACCCCTT CCTCGACGAA GGGAACGACC AGATCTACTT CAAGACGCAC       480
     ATCAAGAAGA TGCGCGACGC GATCGACAAC ACCCGGCGCA TGCGCGAGGT CGTGGGCGAT       540
     CGCGTCGATC TGCTGATCGA GATCCACCGC CGGCTCACCC CGGCCGAGGC CATCGTCTTC       600
     GCCCGCGGCA TCGAAGACAC CCATCCCATG TTCATCGAGG ATCCGATCCG CCCGGAAGGA       660
     CCGGACGGCA TGGCGCGCGT CGCCGAGAAG ATCGGCATTC CGATCGCCAC GGGCGAGCGT       720
     TTCGCCAATC TCTACGAGTT CCAGACGCTG ATGGCGCGCG GCGGCGTCGA ATATGCGCGG       780
     GTGGACCTGT GCCTGTGCGG CGGCATCACC GGAGCCAAGA AGGTCGCGGC CATCGCCGAG       840
     GCCCACCATG TGCAGGTCGT GCCGCACAAC CCGCTGTCGC CGATCGGCCT GGCCGCCTGC       900
     CTGCAGCTCG ATGCCGCGAT CCCGAACTTC GCCATCCAGG AATACGCAAC GGGCTTCGAG       960
     GCCGGCATCT TCGAATCGCG CCCCGAACAC CTGGGCAGCG ACATCGTCGA TCAGGTGCCC      1020
     TTGCCCGATG CGGGCTTCGT CGATATCCCG ACAGGCCCGG GCCTGGGCAT GAATCTATTG      1080
     CCGGATGCCC AGAAGATCCG CCCGCCGCTG GTCAAGCCGA TCTCGATGCG GCCGCATTTC      1140
     GACGGCTTCG TCGTCGACCA GTAG                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page