(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE105

ALDEN1_2.PE105       Location/Qualifiers
FT   CDS_pept        113432..114208
FT                   /locus_tag="Alide_0106"
FT                   /gene_family="HOG000028072" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   dia:Dtpsy_0088 alpha/beta hydrolase fold protein"
FT                   /db_xref="GI:319760843"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="GeneID:10102129"
FT                   /translation="MSLLPGFSLLGSGPTVLLLHDADGDHLSFAPQLETLASAGYRAVA
FT                   WDMPGYGRSAPVEPYGFKGLAQRCLLLLDALRCGEATLVGHGFGAMLALEIALRAPMRV
FT                   RRLVLCAGGPALDAAATAAWVAPRLAALEQGMDMARLADLVARDAGADALPEGLQLARH
FT                   AMGRVYAATYRRALQALTVFARRAPDLARLHVPTLLIGGEQDRCTPPEALLALAHVLPD
FT                   ARAVLLPGVGHWPQLEDPDGFEGALLEFLAMPARLH"
FT                   /protein_id="YP_004124780.1"
     ATGTCTTTGC TGCCAGGCTT TTCCCTCCTG GGCTCCGGCC CCACCGTGCT GCTGCTGCAC        60
     GACGCCGACG GCGATCACCT GAGCTTCGCG CCCCAGCTCG AAACCCTGGC CAGCGCCGGC       120
     TACCGCGCCG TCGCCTGGGA CATGCCGGGT TATGGCCGCA GCGCGCCGGT AGAGCCCTAC       180
     GGCTTCAAGG GACTGGCCCA GCGCTGCCTG CTGCTGCTGG ACGCGCTGCG GTGCGGCGAG       240
     GCCACGCTGG TCGGCCACGG CTTCGGGGCC ATGCTGGCGT TGGAGATCGC GCTGCGCGCC       300
     CCTATGCGGG TGCGGCGGCT GGTGCTGTGC GCGGGCGGCC CGGCGCTCGA TGCAGCGGCC       360
     ACCGCCGCCT GGGTGGCGCC GCGCCTTGCG GCGTTGGAGC AGGGCATGGA CATGGCCCGG       420
     CTGGCCGACC TGGTGGCGCG CGACGCCGGC GCCGATGCCC TGCCCGAGGG GCTGCAGCTG       480
     GCGCGCCACG CCATGGGCCG CGTGTATGCG GCCACCTACC GCCGCGCGCT GCAGGCGCTC       540
     ACCGTCTTTG CGCGCCGCGC GCCGGACCTG GCGCGGCTGC ATGTGCCCAC GCTGCTCATC       600
     GGTGGCGAGC AGGACCGCTG CACCCCGCCC GAGGCGCTGC TGGCCCTGGC CCATGTGCTG       660
     CCCGATGCGC GCGCCGTGCT GCTGCCCGGC GTGGGCCATT GGCCGCAGCT CGAAGACCCC       720
     GATGGCTTCG AGGGCGCGCT GCTGGAATTC CTGGCCATGC CAGCCCGGCT CCATTGA          777
//

If you have problems or comments...

PBIL Back to PBIL home page