(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE108

ALDEN1_2.PE108       Location/Qualifiers
FT   CDS_pept        complement(115419..116264)
FT                   /locus_tag="Alide_0109"
FT                   /gene_family="HOG000259395" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ajs:Ajs_0075
FT                   metallophosphoesterase"
FT                   /db_xref="GI:319760846"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:10102132"
FT                   /translation="MKLQLLSDLHLEVHPHFSPSPAPGADVLVLAGDIGSYQPGSQLAD
FT                   GDFGLARFSPLPQYAGWPTPVVFVPGNHEYDGQDFDTAHTRLRRTCDRLGLIWLERESV
FT                   VLQGVRLVGTTLWSDFDALAGHGADASQGQRLKLREKAFRAADFYLRKTGGTRHGEPFL
FT                   AAQLREQALVCQAWLREALARPFDGATVAVTHFAPSLCSADPRYGMTPGTAGFCNALDD
FT                   CLPHARLWLHGHLHAPSDYLASGTHADGNSWSCRVVANPLGYARKGEQAAFQSHCVLTV
FT                   "
FT                   /protein_id="YP_004124783.1"
     atgaagctgc agctgttgtc cgacctgcac ctcgaagtcc acccccattt cagccccagc        60
     cccgcgcccg gcgccgacgt gctggtgctg gcgggcgaca taggctcgta ccagcccggc       120
     tcgcagctcg ccgacggcga cttcggcctg gcgcgcttct cgccgctgcc gcaatacgcc       180
     ggctggccca cgccggtggt cttcgtgccg gggaaccacg agtatgacgg gcaggacttc       240
     gacaccgcgc acacgcgcct gcgccgcacc tgcgaccgcc tcgggctgat ctggctggag       300
     cgcgagagcg tggttctgca gggcgtgcgc ctggtaggca ccacgctgtg gagcgacttc       360
     gacgcgctgg ccgggcatgg cgccgacgcc tcccagggcc agcggctcaa gctgcgcgag       420
     aaggccttcc gcgccgccga cttctatctg cgcaagaccg gcggcacgcg ccacggcgag       480
     ccgttcctgg cggcgcagct gcgcgagcag gcgctggtgt gccaggcctg gctgcgcgag       540
     gccctggccc ggccattcga cggcgcgaca gtagcagtca ctcacttcgc tcccagcctg       600
     tgcagcgccg acccgcgcta cggcatgacg cccggcaccg cgggcttctg caatgccctg       660
     gacgactgcc tgccccacgc ccggctgtgg ctgcacggcc atctgcacgc cccaagcgac       720
     tacttggcca gcggcacgca tgccgacggc aactcctgga gctgccgcgt agtggccaac       780
     ccgctgggct atgcgcgcaa gggcgagcag gccgcattcc agtcccactg cgtgctcacc       840
     gtatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page