(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE109

ALDEN1_2.PE109       Location/Qualifiers
FT   CDS_pept        complement(116291..117262)
FT                   /locus_tag="Alide_0110"
FT                   /gene_family="HOG000103695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0076 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760847"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102133"
FT                   /translation="MPSLNFRTLDLNLLRVFDEVMAERNLTRAAEKLAITQPAVSNALR
FT                   RLREAVGDELLVRSGHGVEPTPRALALWPAVRQALGQLQESLAPGGFEPASAQATFVLA
FT                   MADATGATLIPPLIEITEREAPGISLRVIPLTTRDPRRLLDDGTIDMAVGYFPAVLADL
FT                   TARAQADNVVAHESVRLYASQYVCVMRAGHPLADAPLSLDQYCAAHHLLVSFSGKPYGF
FT                   IDEALAALGRERRIVLTVNQFFTAGRVVATTDLLTVLPLHFVGLADVGGDLVWRPLPMP
FT                   LPTVHVDALWHRRRLYDPAHRWLRETIARAARNTPTPITLRD"
FT                   /protein_id="YP_004124784.1"
     atgccctcgc tgaacttccg tacgctggac ctgaatctgc tgcgcgtctt cgacgaggtc        60
     atggccgagc gcaatctcac gcgcgcggcc gagaagctgg ccatcaccca gccggcggtg       120
     agcaatgcac tgcgccgcct tcgcgaggcc gtgggggacg agctgctcgt gcgcagcggc       180
     catggcgtgg agcccacgcc gcgggccctg gcgctgtggc ccgcggtgcg ccaggccctg       240
     gggcagttgc aggaatcgct ggcccccggc ggcttcgagc cggcctcggc ccaggccacg       300
     ttcgtgctgg ccatggccga cgccaccggc gccaccctga tcccgccgct catcgaaatc       360
     acggagcgcg aggcgcccgg catctcgctg cgcgtcatac ccctgaccac gcgcgacccg       420
     cgccgcctgc tcgacgacgg gaccatcgac atggccgtgg gctatttccc ggccgtgctg       480
     gccgacctca cggcccgcgc ccaggccgac aacgtggtgg cccatgagag cgtgcgcctg       540
     tacgccagcc agtacgtgtg cgtgatgcgc gccggccatc cgctggcgga tgcgccgctc       600
     tcgctggacc agtactgcgc cgcgcaccac ctgctcgtga gcttctccgg caagccctac       660
     ggcttcatcg acgaggcgct cgccgccctg gggcgcgagc ggcgcatcgt gctcacggtg       720
     aaccagttct tcaccgccgg ccgcgtggtg gccaccaccg acctgctcac cgtgctgccg       780
     ctgcacttcg tgggcctggc cgacgtgggc ggcgacctgg tctggcgccc gctgcccatg       840
     ccgctgccca ccgtgcacgt ggatgcgctg tggcaccgcc ggcgcctata cgacccggcc       900
     caccgctggc tgcgcgagac catcgcgcgc gcggcccgca acacgccgac acccatcacg       960
     ctccgcgact ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page