(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE11

ALDEN1_2.PE11        Location/Qualifiers
FT   CDS_pept        complement(13882..15045)
FT                   /locus_tag="Alide_0011"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reh:H16_A2143 acyl-CoA dehydrogenase,
FT                   long-chain specific"
FT                   /db_xref="GI:319760749"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102034"
FT                   /translation="MMTSDHIALQDSVRKLIEREIEPHVDEWEAAEIFPAHEVFKKLGS
FT                   AGFLGVNKPVEFGGMGLDYSYEIAFCEAIGGISSGGVGMAIAVQTDMATPALTHFGSDE
FT                   LRELFLKPTVAGDMVVCLGVSESGAGSDVASLKTTARKDGDDYVINGSKMWITNGTQAD
FT                   WMCLLANTSEGDVHRNKSLICLPLRENGKLRPGISMQKIKKVGMWASDTAQVFFDEVRV
FT                   PQRYRIGEEGKGFTYQMRQFQEERLSGATRRVTALSNVIDETIAYTRQRKAFGRSILDN
FT                   QAVHFRLAELKTEVEMLRSLIYRAAQVHMGGGDMTELASMAKLKAGRLCREVTDSCLQY
FT                   WGGMGFTWENKVSRAWRDLRLISIGGGADEIMLTIICKHMGILPKRA"
FT                   /protein_id="YP_004124686.1"
     atgatgactt ccgaccatat cgccctgcag gacagcgtgc gcaagctgat cgagcgcgag        60
     atcgagccgc acgtggacga gtgggaggcg gccgagatct tccccgcgca cgaggtgttc       120
     aagaagctgg gctcggccgg cttcctgggc gtgaacaagc ccgtggagtt cggcggcatg       180
     gggctggact acagctacga gatcgccttc tgcgaggcca tcggcggcat cagctcgggc       240
     ggcgtgggca tggccatcgc ggtgcagacc gacatggcga cgccggcgct cacgcatttc       300
     ggctcggacg agctgcgcga gctgttcctc aaacccacgg tggcgggcga catggtggtg       360
     tgcctgggcg tctccgaatc gggcgcgggc tcggacgtgg catcgctcaa gaccacggcg       420
     cgcaaggacg gcgacgacta cgtcatcaac ggctccaaga tgtggatcac caacggcacg       480
     caggccgact ggatgtgcct gctggccaac accagcgagg gcgacgtgca ccgcaacaag       540
     tcgctcatct gcctgccgct gcgcgagaac ggcaagctgc gccccggcat cagcatgcag       600
     aagatcaaga aggtgggcat gtgggcgtcc gacaccgcgc aggtcttctt cgacgaggtg       660
     cgcgtgccgc agcgctaccg catcggcgag gagggcaagg gcttcaccta ccagatgcgc       720
     cagttccagg aagagcgcct gagcggcgcc acgcggcgcg tgacggcgct gtccaacgtc       780
     attgacgaga ccatcgcgta cacgcgccag cgcaaggcct tcggccgctc catcctcgac       840
     aaccaggcgg tgcactttcg cctggccgag ctcaagaccg aggtggagat gctgcgctcg       900
     ctgatctacc gcgcggctca ggtgcacatg ggtggcggcg acatgaccga gctggcctcg       960
     atggcgaaac tgaaggccgg gcgcctgtgc cgcgaggtga cggactcgtg cctgcagtac      1020
     tggggcggca tgggcttcac ctgggagaac aaggtctcgc gcgcctggcg cgacctgcgc      1080
     ctgatctcga tcggcggcgg ggccgacgag atcatgctga ccatcatctg caagcacatg      1140
     ggtattttgc ccaagcgggc ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page