(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE110

ALDEN1_2.PE110       Location/Qualifiers
FT   CDS_pept        117388..117828
FT                   /locus_tag="Alide_0111"
FT                   /gene_family="HOG000224899" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0077"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0077 hypothetical protein"
FT                   /db_xref="GI:319760848"
FT                   /db_xref="GeneID:10102134"
FT                   /translation="MTKFAVIEFPSQHQGVARIEGAVSHLRRSATRFDPTRNGASLLLA
FT                   ALVAALLVVANEMVDTWGDGHLLAGWMLMWLIAFVGMALLAAPARRAVALLRGAAKSWS
FT                   DARRRAAEDERTWNAALHDARIMADLSRAMNGIAVEDMRRYR"
FT                   /protein_id="YP_004124785.1"
     ATGACGAAAT TTGCTGTTAT CGAGTTTCCC AGCCAGCATC AGGGCGTGGC GCGCATCGAG        60
     GGCGCCGTGA GCCATTTACG CCGGAGCGCG ACCCGCTTCG ACCCGACGCG CAACGGAGCC       120
     TCCCTGCTGC TCGCGGCCCT GGTGGCGGCC TTGCTGGTCG TGGCCAACGA GATGGTGGAT       180
     ACCTGGGGCG ACGGCCATCT GCTGGCCGGC TGGATGCTGA TGTGGCTGAT CGCCTTCGTG       240
     GGCATGGCAC TGCTGGCCGC GCCGGCACGC CGCGCCGTGG CGCTGCTGCG CGGCGCGGCC       300
     AAGTCCTGGT CCGATGCGCG CCGGCGTGCG GCTGAGGACG AGCGGACCTG GAACGCCGCG       360
     CTGCACGACG CGCGCATCAT GGCCGACCTG AGCCGTGCCA TGAATGGCAT CGCCGTCGAG       420
     GACATGCGCC GCTATCGCTG A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page