(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE111

ALDEN1_2.PE111       Location/Qualifiers
FT   CDS_pept        complement(117968..119836)
FT                   /locus_tag="Alide_0112"
FT                   /gene_family="HOG000191700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.32"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0114 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="GI:319760849"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="GeneID:10102135"
FT                   /translation="MNAPSMQGLSLQAPAYVKNARLIAWVAEMAALCKPAAIHWCDGSQ
FT                   EEYDQLCQQLVNAGTFKKLNPAKRPGSYLACSDPSDVARVEDRTFICSEKKEDAGPTNN
FT                   WMAPNEMRATLQPLFDGCMAGRTMYVVPFSMGPLGSPIAHVGVELSDSAYVAVNMKIMT
FT                   RMGKAVYDVIGTDGEFVPCMHTVGAPLKAGEKDQTSWPCNPQVKYIVHYPETREIWSYG
FT                   SGYGGNALLGKKCLALRIASTMGRDQGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKT
FT                   NFSMLVPPKAFEGWKVTTIGDDIAWIKPQPDGSLRAINPEAGYFGVAPGTNYHTNPNCM
FT                   ASLNKDVIFTNVALTDDGDVWWEGMEKDTGVVPGHLIDWQGRDWTPQIAKETGAKAAHP
FT                   NARFTVAATNNPALDEAWDDPKGVKIDAFIFGGRRSTTVPLVTEARTWTEGVYMAATMG
FT                   SETTAAAFGAQGVVRRDPFAMLPFMGYNMSDYFQHWLDLGAKIAGQGAALPRIFTTNWF
FT                   RKNAEGKFVWPGYGENMRVLKWMIDRIESRAQGLETAFGIAPAFAEINWNGLEFSAEQF
FT                   ESVTSIDKSVWAEELKLHTEHFDKLAHHLPQELLATKAALEKRLAA"
FT                   /product="phosphoenolpyruvate carboxykinase (gtp)"
FT                   /protein_id="YP_004124786.1"
     atgaacgccc cctccatgca aggcctgagc ctgcaggccc ccgcctatgt caagaacgcc        60
     cgcctgatcg cctgggtggc cgaaatggcc gccctgtgca agcccgccgc catccactgg       120
     tgtgacggca gccaggagga atacgaccag ctgtgccagc agctggtcaa tgccggcacc       180
     ttcaagaagc tcaaccccgc caagcgcccg ggcagctacc tggcctgctc cgacccgtcg       240
     gacgtggccc gcgtcgaaga ccgcaccttc atctgctccg agaagaagga agacgccggc       300
     cccaccaaca actggatggc gcccaacgag atgcgcgcca cgctgcagcc gctgttcgac       360
     ggctgcatgg ccggccgcac catgtacgtg gtgccgttct cgatgggccc actgggcagc       420
     ccgatcgccc acgtgggcgt ggaactgtcc gacagcgcct acgtggccgt gaacatgaag       480
     atcatgacgc gcatgggcaa ggcggtatac gatgtgatcg gcaccgatgg cgagttcgtg       540
     ccctgcatgc acaccgtggg cgcgccgctc aaggccggcg agaaggacca gaccagctgg       600
     ccctgcaacc cccaggtcaa gtacatcgtg cactaccccg agacgcgcga gatatggagc       660
     tacggctcgg gctatggcgg caacgccctg ctgggcaaga aatgcctggc gctgcgcatc       720
     gcatccacca tgggccgcga ccagggctgg ctggccgagc acatgctgat cctgggcgtg       780
     accaaccccg agggcaagaa gtaccacgtg gccgcagcct tcccgagcgc ctgcggcaag       840
     accaacttct ccatgctggt gcccccgaag gccttcgaag gctggaaggt cacaaccatc       900
     ggcgacgaca tcgcctggat caagccccag cccgacggtt ccctgcgcgc catcaacccc       960
     gaggcaggct acttcggcgt cgcccccggc acgaactacc acaccaaccc caactgcatg      1020
     gccagcctca acaaggacgt gatcttcacg aacgtcgcgc tgacagacga cggcgacgtg      1080
     tggtgggaag gcatggaaaa ggacaccggc gtggtccccg ggcacctgat cgactggcag      1140
     ggccgcgact ggacgccgca aatcgccaag gaaaccggcg ccaaggccgc ccaccccaac      1200
     gcccgcttca ccgtggccgc caccaacaac ccggcactgg acgaggcctg ggacgacccc      1260
     aaaggcgtga agatcgacgc ctttatcttc ggcgggcgcc gctccaccac cgtgccgctg      1320
     gtgaccgagg cgcgcacctg gaccgagggc gtgtacatgg ccgccaccat gggctccgag      1380
     accactgccg ccgccttcgg cgcgcaaggc gtggtgcgcc gcgatccctt cgccatgctg      1440
     cccttcatgg gctacaacat gagcgactac ttccagcact ggctggacct gggcgccaag      1500
     atcgccggcc agggcgcggc cctgcccagg atcttcacga ccaactggtt ccgcaagaac      1560
     gccgagggca agttcgtctg gcccggctac ggcgagaaca tgcgcgtgct caagtggatg      1620
     atcgaccgca tcgaaagccg cgcgcaaggc ctggaaacgg ccttcggcat cgcccccgca      1680
     tttgccgaaa tcaactggaa cggcctggaa ttcagcgccg agcagttcga gagcgtgacc      1740
     agcatcgaca agagcgtctg ggccgaggaa ctgaagctgc acaccgagca cttcgacaag      1800
     ctcgcccacc acctgcccca ggaactgctg gccaccaagg ccgccctgga aaagcgcctg      1860
     gccgcctga                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page