(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE113

ALDEN1_2.PE113       Location/Qualifiers
FT   CDS_pept        complement(120427..121626)
FT                   /locus_tag="Alide_0114"
FT                   /gene_family="HOG000046972" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /codon_start="1"
FT                   /product="threonine dehydratase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0099 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="GI:319760851"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="GeneID:10102137"
FT                   /translation="MFSIQDIQDAAARLRGQVLDTPCVESRTLSQVTGAQVFLKFENLQ
FT                   FTASFKERGACNKLSQLTPEERKRGVVAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPG
FT                   VKVERTRGFGAEVVLHGDTLEEAHRHAHLLAGQQGLTFVHPYDDEAVAAGQGTLALEML
FT                   AEQPDLDVLVVSVGGGGLLAGMATAARALKPSLEIVGVQTARFPAMVNAVKGTQHEQGM
FT                   STIAEGIAVGQPGRMTREVIARLVDDLLLVQEGDIEQAVLMLLEIEKTLVEGAGAAGLA
FT                   ALVRYPERFRGKKVGLVLSGGNIDPLLLAAIIERGMVRSGRLARIKVSARDVPGVLARI
FT                   TATVAEAGANIEEVHHQRAFTLLAAQNVEIELVLQTRGKAHVQQVLEQLRAAHMEAELH
FT                   "
FT                   /protein_id="YP_004124788.1"
     atgttttcca tccaagacat ccaggacgcc gccgcccgcc tgcgcggcca ggtgctcgac        60
     acgccctgcg tggaatcgcg cacgctctcg caggtcacag gcgcgcaagt gttcctcaag       120
     ttcgagaacc tgcagttcac cgcctcgttc aaggagcgcg gcgcctgcaa caagctgagc       180
     cagctcaccc ccgaggagcg taagcgcggc gtcgtggcca tgagcgccgg caaccacgcc       240
     cagggcgtgg cctaccatgc gcagcgcctg ggcctgcgcg cggtgatcgt catgccgcgc       300
     ttcacgcccg gcgtgaaggt ggagcgcacg cgcggcttcg gggccgaggt ggtgctgcac       360
     ggcgacaccc tggaggaagc gcaccggcac gcccatctgc tcgccgggca gcagggcctg       420
     accttcgtgc acccctacga cgacgaggcc gtggccgccg gccagggcac gctggcgctg       480
     gagatgctgg ccgaacagcc cgacctggac gtgctggtcg tctcggtcgg cggcggcggc       540
     ctgctggccg gcatggccac ggcggcgcgc gccctcaagc ccagtctgga gatcgtgggt       600
     gtgcagacgg cgcgctttcc ggccatggtc aacgccgtca agggcacgca gcacgagcag       660
     ggcatgtcca cgatcgccga gggcatcgcc gtgggccagc cgggccgaat gacgcgcgaa       720
     gtgatcgccc gcctggtcga cgacctgctg ctggtgcagg agggcgacat agagcaggcc       780
     gtgctcatgc tgctggagat cgagaagacc ctggtcgagg gcgcgggcgc ggccggcctg       840
     gccgccctgg tgcgctaccc cgagcgcttt cgcggcaaga aggtggggct ggtgctctcc       900
     ggcggcaaca tcgacccatt gctgctggcc gccatcattg agcgcggtat ggtgcgctcc       960
     gggcgcctgg cgcgcatcaa ggtcagcgcg cgcgacgtgc ccggcgtgct ggcgcgcatc      1020
     accgccaccg tggccgaggc cggcgccaac atcgaagagg tgcaccacca gcgcgccttc      1080
     accctgctgg ccgcgcagaa cgtggagatc gagctggtgc tgcagacgcg cggcaaggcc      1140
     cacgtccagc aggtgctgga gcagctgcgc gccgcccaca tggaggccga gctgcactga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page