(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE115

ALDEN1_2.PE115       Location/Qualifiers
FT   CDS_pept        complement(123446..126166)
FT                   /locus_tag="Alide_0116"
FT                   /gene_family="HOG000265624" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /codon_start="1"
FT                   /product="magnesium-translocating p-type atpase"
FT                   /transl_table="11"
FT                   /note="KEGG: pfl:PFL_4078 magnesium-transporting ATPase
FT                   MgtA; TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:319760853"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015444"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:10102139"
FT                   /translation="MHPHIPREVFAGFLRTRRMVRHFRRRALLETLGRTGVSRELPAAQ
FT                   SRALAAAADADAGALLRQLGSAETGLTEAQADAMRERAGPNEVEHEKPLPWWVHLWHCF
FT                   RTPFSLLLTLLAAISLFTRDMKGALVIGTMVVLATLLRFWQEGRSSKAADALKAMVGNT
FT                   ATVLRGSLPEDAGVRRVELPIRLLVPGDLVVLSAGDMIPADCRVLAAKDLFVAQAAMTG
FT                   ESMPVEKSAARCGAGAGNPLELDNIVFMGTNVVSGSATAVVLATGGGTYFGALAGRVIA
FT                   TDRAPTSFQSGVNKVSWLLIRFMSAMAPLVFFINGFSKGDWLEALLFALAIAVGLTPEM
FT                   LPMIVTSTLAKGAVFLSRKKVIVKRLDAIQNFGAMDVLCTDKTGTLTQDRIFLARHVDA
FT                   WGEESGDVLELAYLNSYYQTGLKNLLDVAVLEHAEVHRELEPARNFRKVDEIPFDFDRR
FT                   RMSVVVAEHGAHHLLITKGAVEEVLAVCTQVRHGAATEPLTPALLERIRAVTAGLNEEG
FT                   LRVVAVAARQGPPTQDVYGLADESALTLVGYVAFLDPPKDSTAAALKALAGRSVAVKVL
FT                   TGDNELVAAKICREVGLAQQGVLRGGDVERMGDEELGHAVERHNLFARLTPMHKERIVR
FT                   RLKANGHVVGFMGDGINDAPALRAADIGISVDSAVDIAKEAADIILLEKSLMVLEQGVQ
FT                   EGRRTFANMLKYIRMTASSNFGNVLSVLTASAFIPFLPMLPIHLLVQNLLYDISQIAIP
FT                   FDNVDEELLRRPLRWQPGDIGRFMVFFGPVSSVFDITTFAMMWFVFGAQTPAQQTLFQS
FT                   GWFVVGLLTQTLIVHMIRSPGLPFVQSRAATPLLVMTGAIMAVGIFLPMGPLAHYFRLQ
FT                   ALPPLYFALLPAIVLGYMAATQAMKGIYRRRWGWQ"
FT                   /protein_id="YP_004124790.1"
     atgcaccccc acatcccgag agaggtcttc gccggtttcc tgcgcacgcg ccgcatggtc        60
     cggcacttcc gccgccgggc cctgctggag accctgggcc gcaccggcgt cagccgggaa       120
     ctgcccgcgg cgcagtccag ggcgctggcc gcggcggcgg acgccgatgc cggggccctg       180
     ctgcggcagc tcggcagcgc cgagaccggc ctgaccgagg cgcaggccga cgccatgcgc       240
     gagcgcgcgg gccccaacga ggtggagcac gagaagccgc tgccctggtg ggtgcacctg       300
     tggcactgct ttcgcacccc gttcagcctg ctgctgacgc tgctggccgc catctcgctc       360
     ttcacccgcg acatgaaggg cgccctggtg atagggacca tggtggtgct ggccaccctg       420
     ctgcgcttct ggcaggaggg ccggtccagc aaggcagccg acgcgctcaa ggccatggtc       480
     ggcaacacgg cgacggtgct gcgcggcagc ctgcccgaag acgccggcgt gcgccgcgtg       540
     gagctgccga tcaggctgct ggtgcccggc gacctggtcg tgctgtcggc cggcgacatg       600
     atcccggccg actgccgcgt actcgcggcc aaggacctgt tcgtggcgca ggcggccatg       660
     accggcgagt ccatgccggt ggagaagtcg gccgcccgat gcggcgcggg cgccggcaac       720
     ccgctggagc tggacaacat cgtgttcatg ggcaccaacg tcgtttccgg ctcggccacg       780
     gccgtggtgc tggcgacggg cggcggcacc tacttcggcg ccctggccgg ccgcgtcatc       840
     gccaccgacc gcgcgcccac ctcgttccag tcgggcgtga acaaggtcag ctggctgctc       900
     atccgcttca tgtccgcgat ggcgccgctg gtgttcttca tcaatggctt ctccaagggc       960
     gactggctcg aagccctgct gttcgccctg gccatcgccg tgggcctgac gcccgagatg      1020
     ctgcccatga tcgtgacctc cacgctggcc aagggcgcgg tgttcctgtc gcgcaagaag      1080
     gtcatcgtga agcggctgga cgcgatacag aacttcggcg ccatggacgt gctgtgcacc      1140
     gacaagaccg gcacgctgac gcaggacagg atcttcctgg cgcgccacgt cgatgcctgg      1200
     ggcgaggagt ccggcgacgt gctggagctg gcctacctca acagctacta ccagacgggc      1260
     ctgaagaacc tgctggacgt ggccgtgctg gagcacgccg aggtgcaccg cgagctcgaa      1320
     cccgccagga acttccgcaa ggtcgacgag atcccgttcg acttcgaccg ccgccgcatg      1380
     tcggtggtgg tggccgagca cggcgcgcac catctgctca tcaccaaggg cgcggtggag      1440
     gaagtcctgg ccgtgtgcac ccaggtgcgc cacggcgcgg ccaccgagcc cctgacgccc      1500
     gcgctgctgg agcgcatccg cgccgtgacg gccgggctca acgaggaagg cctgcgagtg      1560
     gtggccgtgg ccgcccggca gggaccgccc acgcaggacg tctacggtct ggccgacgaa      1620
     agcgccctga ccctggtcgg ctacgtggcc ttcctcgacc cgcccaagga ctccacggcc      1680
     gcggcgctga aggcgctggc cgggcgcagc gtggccgtga aggtgctgac cggcgacaac      1740
     gagctggtgg ccgccaagat ctgccgcgag gtgggcctgg cgcagcaggg cgtgctgcgg      1800
     ggcggcgacg tggagcgcat gggcgacgag gagctgggcc atgccgtgga gcgccacaac      1860
     ctcttcgcca ggctcacgcc catgcacaag gaacgcatcg tgcgccggct caaggccaac      1920
     gggcacgtgg tgggcttcat gggcgacggc atcaacgacg cgccggcgct gcgcgcggcc      1980
     gacatcggca tctcggtgga cagcgcggtg gacatcgcca aggaggccgc cgacatcatc      2040
     ctgctggaga agagcctgat ggtgctggag cagggcgtgc aggagggccg gcgcaccttc      2100
     gccaacatgc tcaagtacat caggatgacg gccagctcca acttcggcaa cgtgctgtcg      2160
     gtgctcacgg cctcggcctt cataccgttc ctgccgatgc tgcccataca cctgctggtg      2220
     cagaacctgc tgtacgacat ctcgcagatc gccattccgt tcgacaacgt ggacgaggag      2280
     ctgctgcgcc ggccactgcg ctggcagccg ggcgacatag gccgcttcat ggtgttcttc      2340
     gggcccgtca gctcggtgtt cgacatcacg accttcgcca tgatgtggtt cgtcttcggc      2400
     gcgcagacgc ccgcgcagca gacgctgttc cagtcgggct ggttcgtcgt gggtctgctg      2460
     acgcagaccc tgatcgtgca catgatccgc agccccggtc tgcccttcgt ccagagccgc      2520
     gcggccacgc cgctgctggt gatgacgggc gccatcatgg ccgtcggcat cttcctgccc      2580
     atggggccgc tggcacacta cttcaggctg caggcgctgc cgccgctgta cttcgcgctg      2640
     ctgccggcca tcgtgctggg ctacatggca gcgactcagg ccatgaaggg catctaccgg      2700
     cggcgctggg gctggcaata a                                                2721
//

If you have problems or comments...

PBIL Back to PBIL home page