(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE116

ALDEN1_2.PE116       Location/Qualifiers
FT   CDS_pept        complement(126301..127332)
FT                   /locus_tag="Alide_0117"
FT                   /gene_family="HOG000265279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /codon_start="1"
FT                   /product="homocysteine s-methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ajs:Ajs_0083 methionine synthase (B12-dependent)"
FT                   /db_xref="GI:319760854"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="GeneID:10102140"
FT                   /translation="MTLPHYTRAQQLPAILEQRIAILDGAMGTMIQRFKLTEEQYRGER
FT                   FKDFARDVKGNNELLSLTRPNVIRDIHEGYLAAGADLIETNTFGATSIAQEDYGMADLA
FT                   YEMNLESARLARAACGKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVTFEQLRA
FT                   AYLEQTLALIAGGADVLLVETIFDTLNAKAALFAIDEAFEQTGECLPIMISGTVTDASG
FT                   RILSGQTVTAFWHSVRHANPLSIGLNCALGAALMRPYIQELAKAAPDTFISCYPNAGLP
FT                   NPMSDTGFDETPEVTSRLVHEFATERLVNIVGGCCGTTPDHIGAIARAVAPVGARRLFS
FT                   AVS"
FT                   /protein_id="YP_004124791.1"
     atgaccctgc cccactacac ccgcgcccag cagctgcccg ccatcctcga acagcgcatc        60
     gccatcctcg acggcgccat gggcaccatg atccagcgct tcaagctcac cgaggagcag       120
     taccggggcg agcgcttcaa ggactttgcg cgcgacgtga aaggcaacaa cgaactgctc       180
     agcctcacgc ggcccaacgt gatccgcgac atccacgagg gctacctcgc cgccggcgcc       240
     gacctgatcg agaccaacac cttcggcgcg accagcatcg cgcaggagga ctacggcatg       300
     gccgacctgg cctacgagat gaacctggag agcgccaggc tcgcgcgcgc ggcctgcggc       360
     aagttcagca cgccggacaa gccccgcttc gtggccggcg cgctcggccc cacgcccaag       420
     accgccagca tcagccccga cgtgaacgac cccggcgcgc gcaacgtgac cttcgagcag       480
     ctgcgcgcgg cctacctgga gcagacgctc gcgctcatcg cgggcggcgc cgacgtgctg       540
     ctggtcgaga ccatcttcga caccctgaac gccaaggccg cgctgttcgc catcgacgag       600
     gcgttcgagc agaccggcga atgcctgccc atcatgatca gcggcacggt gacggacgcc       660
     tcgggccgca tcctctcggg ccagaccgtg acggccttct ggcacagcgt gcgccacgcc       720
     aacccgctct cgatcggtct gaactgcgcc ctgggcgcgg cgctgatgcg cccctacatc       780
     caggagcttg ccaaggccgc gcccgacacc ttcatcagct gctaccccaa cgccggcctg       840
     cccaacccca tgagcgacac cggcttcgac gagacgcccg aggtcacgag ccgcctggtg       900
     cacgagttcg ccaccgagag gctggtgaac atcgtgggcg gctgctgcgg caccacgccg       960
     gaccacatcg gcgccatcgc gcgcgcggtg gcgccggtgg gcgcgcgcag gctgttttcg      1020
     gccgtctcct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page