(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE118

ALDEN1_2.PE118       Location/Qualifiers
FT   CDS_pept        complement(128355..129518)
FT                   /locus_tag="Alide_0119"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: aav:Aave_0176 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760856"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102142"
FT                   /translation="MNFALTPEQEQIQAAIERVCEPFDADYWLKKDQEGGFPHDFHQAL
FT                   AESGWLGIAMPEEYGGAGLGISEAALMMHTISATGAGLSGASAVHMNIFGLHPVVVFGT
FT                   DEQKKRWLPPLIQGKDKACFGVTEPNAGLNTLKLQTRAVREGDHYVVHGQKVFISTAQV
FT                   ANKILLLTRTRPAEECKGTEGLTLFYTDLDRSKVEVREIAKLGRKCVDTNQLFIDGLRI
FT                   PVEDRVGEEGKGFSYILHGMNPERILIAAEAVGLGRAALARAAGYAAEREVFGRPIGKN
FT                   QAIQHPLAEAWMDLEAAHLMVQKAAWLYDQGANCGAEANAAKFLGAEAGYRACERAIFT
FT                   HGGMGYAKEYHVERYMRESWIPRLAPVSPQLILCFIAEKVLGLPKSY"
FT                   /protein_id="YP_004124793.1"
     atgaacttcg cactcacccc cgaacaggaa cagatccagg ccgccatcga gcgcgtctgc        60
     gagcccttcg acgccgacta ctggctcaag aaagaccagg aaggcggctt cccgcacgac       120
     ttccaccagg cgctggccga gtccggatgg ctcggcatcg ccatgcccga ggaatacggc       180
     ggcgcgggcc tggggatcag cgaggccgcg ctgatgatgc acaccatctc ggccacgggc       240
     gcgggcctgt cgggggcgtc ggccgtgcac atgaacatct tcggcctgca ccccgtggtc       300
     gtcttcggca ccgacgagca gaagaagcgc tggctgccgc cgctgatcca gggcaaggac       360
     aaggcctgct tcggcgtgac cgagcccaac gcgggcctga acaccctgaa gctgcagacg       420
     cgcgccgtgc gcgagggcga ccactacgtg gtgcacgggc agaaggtctt catctccacc       480
     gcccaggtgg ccaacaagat cctgctgctc acgcgcaccc ggccggcgga ggaatgcaag       540
     ggcaccgagg gcctgacgct gttctacacc gacctggacc gcagcaaggt cgaggtacgc       600
     gagatcgcca agctgggccg caagtgcgtg gacaccaacc agctgttcat cgacggcctg       660
     cgcattcccg tggaggaccg cgtgggcgag gagggcaagg gcttctccta catcctgcac       720
     ggcatgaacc ccgagcgcat cctgatcgcc gcagaggccg tgggcctggg ccgcgccgcc       780
     cttgcgcgcg cggcgggcta cgcggccgag cgcgaggtgt tcggccgccc catcggcaag       840
     aaccaggcca tacagcaccc gctggccgag gcctggatgg acctggaggc cgcgcacctc       900
     atggtgcaga aggccgcctg gctgtacgac cagggcgcca actgcggcgc cgaggccaac       960
     gccgccaagt tcctcggcgc cgaggccggc taccgcgcct gcgagcgcgc catcttcacg      1020
     cacggcggca tgggctacgc caaggaatac cacgtggaac gctacatgcg cgagtcgtgg      1080
     ataccgcgcc tggcgcccgt gagcccgcag ctcatcctgt gcttcatcgc ggagaaggtg      1140
     ctgggcctgc ccaagtcgta ttga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page