(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE119

ALDEN1_2.PE119       Location/Qualifiers
FT   CDS_pept        complement(129515..129898)
FT                   /locus_tag="Alide_0120"
FT                   /gene_family="HOG000224904" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   aav:Aave_0177 cupin 2 domain-containing protein"
FT                   /db_xref="GI:319760857"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:10102143"
FT                   /translation="MTTSRYLVRAADVPSYQPANHHHTHNQRLIGPETVGAKQMEVLLG
FT                   TLHKGGGALPHAHPGIEQACYLLEGTARAQVEDEAFDMVPGDMCFFPADKMHVFTVTSD
FT                   QPVKLLVIYSPPYGESPDKVIRP"
FT                   /protein_id="YP_004124794.1"
     atgaccacgt cccgctacct ggtgcgcgcc gccgacgtgc ccagctacca gcccgccaac        60
     caccaccaca cgcacaacca gcgcctgatc ggccccgaga ccgtgggtgc caagcagatg       120
     gaggtgctgc tgggcacgct gcacaagggc ggcggcgcgc tgccgcacgc ccatcccggc       180
     atcgagcagg cctgctacct gctcgaaggc acggcccggg cccaggtgga ggacgaggcc       240
     ttcgacatgg tgccgggcga catgtgcttc ttcccggccg acaagatgca cgtcttcacc       300
     gtcaccagcg accagcccgt caagctgctc gtgatctata gcccgcccta cggcgaatcg       360
     cccgacaagg taatccgacc atga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page