(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE123

ALDEN1_2.PE123       Location/Qualifiers
FT   CDS_pept        complement(133668..133868)
FT                   /locus_tag="Alide_0124"
FT                   /gene_family="HOG000100312" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0105"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0105 hypothetical protein"
FT                   /db_xref="GI:319760861"
FT                   /db_xref="GeneID:10102147"
FT                   /translation="MSHFSTTEQAALAAVQLTDDERQPCEVWTRVMGYHRPVASFNVGK
FT                   QGEHNERQFFSEHARGCSNAC"
FT                   /protein_id="YP_004124798.1"
     atgagccatt tctccaccac cgaacaagcc gccctggccg ccgtgcagct caccgacgac        60
     gagcgccagc cctgcgaggt ctggacccgc gtgatgggct accaccgccc cgtggccagc       120
     ttcaacgtgg gcaagcaggg cgagcacaac gagcgccagt tcttctccga gcacgcgcgt       180
     ggctgcagca acgcctgctg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page