(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE124

ALDEN1_2.PE124       Location/Qualifiers
FT   CDS_pept        complement(133951..135981)
FT                   /locus_tag="Alide_0125"
FT                   /gene_family="HOG000100301" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /codon_start="1"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0106 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: ATP-cone
FT                   domain protein"
FT                   /db_xref="GI:319760862"
FT                   /db_xref="GO:0008998"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="GeneID:10102148"
FT                   /translation="MTPPPAPVATLPRDVIQRNGERAAFDAERIRSAIARAGSATGDFG
FT                   ADEAQLLTAQATKVLIHRFRGEAPAIEQIQDVVEQTLIAANHLQTARAYMAHRQRHALL
FT                   RADRQTLVHVESSINEYLTRADWRVNANANQGYSLGGLILNVAGKVTANYWLSHVYAPE
FT                   IGEAHRSGDIHIHDLDMLSGYCAGWSLRTLLHEGLNGVPGKVEAGPPKHMSSAVGQIVN
FT                   FLGTLQNEWAGAQAFSSFDTYMAPFVRKDAMDYAAVRQCIQELVYNLNVPSRWGTQTPF
FT                   TNLTFDWTCPEDLREQVPVIGGEEMPSSYGELQAEMDLINRAYIDVMTTGDAKGRVFTF
FT                   PIPTYNITPDFPWESENAAALFDMTAKYGLPYFQNFINSELSPNMVRSMCCRLQLDLRE
FT                   LLKRGNGLFGSAEQTGSLGVVTVNCARLGYLHAGDEASLFAALDRLLELGKQSLEVKRK
FT                   LIQRLMDQGLFPYTKRYLGTLRNHFSTLGVNGINEMIRNFTADAHDITSEWGHAFAVRL
FT                   LDHVRARMTAFQEETGHLYNLEATPAEGTTYRFAKEDKKRWPAILQAGTAEQPYYTNSS
FT                   QLPVGFTDDPFEALQRQEALQGKYTGGTVLHLYMGERISSGAACRELVKRALTNFRLPY
FT                   ITVTPTFSICPTHGYLAGEHPFCPTCDEERLEAKRRRLLAA"
FT                   /protein_id="YP_004124799.1"
     atgacgccac caccagcccc tgtcgccacc ctgccgcgcg acgtgatcca gaggaacggc        60
     gagcgcgccg cgttcgatgc cgagcgcatc cgctcggcca tcgcgcgcgc gggcagcgct       120
     accggcgatt tcggtgccga cgaggcgcag ttgctcaccg cccaggcgac caaggtgctc       180
     atccaccgct tccgcggcga ggcgcccgcc atcgagcaga tccaggacgt ggtggagcag       240
     acgctgatcg ccgccaacca cctgcagacc gcgcgcgcct acatggccca ccgccagcgc       300
     cacgcgctgc tgcgcgccga ccggcagacg ctggtgcacg tggaaagctc catcaacgaa       360
     tacctcacgc gcgccgactg gcgcgtgaac gccaacgcca accagggcta ctcgctcggc       420
     gggctgatcc tgaacgtggc cggcaaggtc acggccaact actggctctc gcacgtctac       480
     gcgcccgaga tcggcgaggc gcaccgcagc ggcgacatcc acatccacga cctggacatg       540
     ctcagcggct actgcgccgg ctggtcgctg cgcacgctgc tgcacgaggg cctgaacggc       600
     gttccgggca aggtggaggc ggggccgccc aagcacatga gctccgccgt ggggcagatc       660
     gtgaacttcc tgggcacgct gcagaacgag tgggcgggcg cgcaggcgtt ctcctcgttc       720
     gacacctaca tggcgccctt cgtgcgcaag gacgccatgg actacgccgc cgtgcgccag       780
     tgcatccagg agctggtcta caacctcaac gtgccctcgc gctggggcac gcagacgccg       840
     ttcaccaacc tcaccttcga ctggacctgc cctgaggacc tgcgcgagca ggtgcccgtg       900
     atcggcggcg aggaaatgcc ctccagctac ggcgagctgc aggccgagat ggacctcatc       960
     aaccgcgcct acatcgacgt gatgaccacg ggcgacgcca agggccgcgt gttcaccttc      1020
     cccattccca cgtacaacat cacgcccgac ttcccgtggg agagcgagaa cgccgccgcg      1080
     ctgttcgaca tgacggccaa gtacggcctg ccgtacttcc agaacttcat caactccgag      1140
     ctttcgccga acatggtgcg ctccatgtgc tgccgcctgc agctcgatct gcgcgagcta      1200
     ttgaagcgcg gcaacggcct gttcggcagc gccgagcaga ccggcagcct gggcgtggtc      1260
     accgtcaact gcgcgcggct gggctacctg cacgcgggcg atgaggcgag cctgttcgcc      1320
     gccctggatc gcctgctgga gctgggcaag cagagcctgg aagtcaagcg caagctcatc      1380
     cagcgcctca tggaccaggg cctgttcccc tacaccaagc gctacctggg cacgctgcgc      1440
     aaccatttca gcacgctggg cgtgaacggc atcaacgaga tgatccgcaa cttcacggcg      1500
     gacgcgcacg acatcaccag cgaatggggc cacgccttcg ccgtgcgcct gctggaccac      1560
     gtgcgcgcgc gcatgacggc cttccaggag gaaaccggcc acctctacaa cctcgaagcc      1620
     acgcccgccg agggcacgac ctaccgcttc gccaaggaag acaagaagcg ctggcccgcc      1680
     atcctgcagg ccggcacggc cgagcagccg tactacacca acagctcaca gttgcccgtg      1740
     ggcttcaccg acgacccgtt cgaggcgctg cagcggcaag aggccctgca gggcaagtac      1800
     accggcggca ccgtgctgca cctgtacatg ggcgagcgca tctccagcgg cgcggcctgc      1860
     cgcgagctgg tgaaacgggc gctgacgaac ttccgcttgc cctacatcac cgtcacgccc      1920
     acgttctcca tctgccccac gcacggctac ctggcgggcg agcacccgtt ctgccccacg      1980
     tgcgatgaag agcggctgga ggcgaagcgc cggcgcctgc tcgcggcttg a               2031
//

If you have problems or comments...

PBIL Back to PBIL home page