(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE125

ALDEN1_2.PE125       Location/Qualifiers
FT   CDS_pept        complement(136106..139408)
FT                   /locus_tag="Alide_0126"
FT                   /gene_family="HOG000224109" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   ajs:Ajs_0088 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAC repeat-containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="GI:319760863"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:10102149"
FT                   /translation="MMHPTHRTELRKSLYWLAGLLAGLLLVQLFPAPDAARGLARYLPL
FT                   HTSMEVLSIAMAAMVFGIAWATQKYRPNGRDLVLGPGLLGVAILDMSHCLSYAGMPDFI
FT                   TPNGPEKAILFWLAARSLAALALLCAAFWPQRHDNRLGPRARCWSLACVLLFVGAVHYV
FT                   VLLHPQSVPPTFIPGVGLTKFKIDFEYGLIAAYVLAGMGFLTHLRQDREFGLTRLALAA
FT                   FTMAMGEFFFTLYANVTDIYNVTGHLYKIMACAFLYRGLFVETVQAPYQELQASEAQHR
FT                   AMLDTLPDLLFELNRQGVYLSVHANDASKLAAPAGQLLGRRLGEILPAQAAAACLDALA
FT                   EAERSGVARGQRFRLALPSGVHHFELAIARKANPAGREDTYLTLVRDITATVHDEQRIA
FT                   FEARLNASLLDLQHSDVQELEADFLQRGIRHVERLTHSPFAVLHFVHDGQDPELAACSA
FT                   GAAGGMPAQAEVWRQECAAQRIQNQPPPGDALLRWMSLPVQEGGRTRMLLGVANKAEDY
FT                   DRQDAQALQALAYAIWRRVVQRRQDAVILRLSEALEQSPHQVVITDVRANVLYVNRAFS
FT                   EVSGYSAQEILGKNPRMLQSGLTPRSVYEEMWRRLPQGQPWQGELVNRRKNGHIYTEIV
FT                   SLYPIRDLSGQVTHYVAHKEDITVQREAEERIQALSNFDTLTGLLNKKSFDERLALAIE
FT                   RAGASHGRLSMLWFDLDNFKLINESLGHTAGDELLVEAANRLRSCLGTQNALARYSGDA
FT                   FVAIVPQADQASVALMAQEALRLLQTATSVQGHPVSVSASAGVAVYPDDARTAGTLASA
FT                   AELAMYRVKEDGRNGLRFFAPEMQAHTQRSLELAAGLKDAARKGELFLVYQPQRALGSG
FT                   ALVGAEALLRWRHPQWGLVSPAEFIPIAEQSGAITAIDFWVVEQAAQQLRAWDAAGLPP
FT                   LVVAVNVSAAQFARPQLAEELLHILQRVDVSPQRIEVELTEAVALKHPELAETTIRRLH
FT                   DMGFKVALDDFGTGYSSMSYLKRYTIDKLKIDQSFVRELAEKTSDMAIVTAIVRMAHSL
FT                   HLSTLAEGVETAEQAALLHDCGCDEIQGYWYSRPLEPRAFEAFAKGLPQRGA"
FT                   /protein_id="YP_004124800.1"
     atgatgcacc ccacacatcg aacggagctt cgcaaatccc tctactggct cgccggcctg        60
     ctggccgggc tgttgctggt gcagctgttc ccggcgcctg acgccgcccg gggcctggcg       120
     cgctacctgc cgctgcacac gagcatggag gtgctctcca tcgccatggc ggccatggtg       180
     ttcggcattg cctgggccac gcagaaatac cggcccaacg ggcgcgacct cgtcctcggc       240
     ccgggcctgc tgggcgtggc catcctggac atgagccact gcctgtccta cgcgggcatg       300
     ccggacttca tcacccccaa cgggccggaa aaagccattc ttttctggct ggcggcgcgc       360
     agcctcgcgg ccctggccct gctgtgcgcg gccttctggc cgcagcgcca cgacaaccgg       420
     ctgggcccgc gcgcgcgctg ctggagcctt gcgtgcgtgc tgctgttcgt gggcgcggtg       480
     cactacgtgg tgctgctcca cccgcagtcg gtgccgccca ccttcatccc aggcgtgggg       540
     ctgacgaaat tcaagatcga cttcgagtac ggcctgatcg ccgcctacgt gctggcgggc       600
     atgggctttc tgacgcatct gcgccaggac cgcgaattcg gcctgacgcg cctggcgctg       660
     gccgcattca ccatggccat gggcgagttc ttcttcacgc tctacgccaa cgtcaccgac       720
     atctacaacg tgaccgggca cctctacaag atcatggcct gtgccttcct gtaccggggc       780
     ctgttcgtgg agacggtgca ggcgccgtac caggagctgc aggcttccga ggcccagcac       840
     cgggccatgc tggacacgct gcccgacctg ctgttcgagc tgaaccgcca gggcgtctac       900
     ctgtcggtgc acgccaacga cgcgagcaag ctggcggcgc cggccggcca actgctgggc       960
     aggcggctcg gcgagatcct gcccgcgcag gccgccgccg cgtgcctcga cgcgctggcc      1020
     gaggccgagc gcagcggcgt ggcccgcggc cagcgcttcc gcctagcgct gccgtccggc      1080
     gtgcaccact tcgagctagc catcgccagg aaggccaatc ccgcggggcg cgaggacacc      1140
     tacctgaccc tggtgcggga catcaccgcc acggtgcacg acgagcagcg catcgcgttc      1200
     gaggcccgcc tgaacgcgag cctgctggac ctgcagcaca gcgacgtcca ggagctcgag      1260
     gcggacttcc tgcagcgtgg catccggcat gtcgagcggc tcacgcacag tccgttcgcc      1320
     gtcctgcatt tcgtgcacga tggccaggac cccgagctcg cggcctgttc ggcgggagcg      1380
     gcgggcggca tgccggccca ggcggaagtc tggcgccagg agtgcgccgc ccagcgcatc      1440
     cagaaccagc cgccgcccgg cgacgccctg ctgcgctgga tgagcctgcc cgtgcaggaa      1500
     ggcggccgca cgcgcatgct gctgggcgtg gccaacaagg ccgaggacta cgacaggcag      1560
     gacgcccagg cgctgcaggc cctggcctac gccatctgga ggcgcgtggt gcagcgccgc      1620
     caggatgcgg tcatcctgcg cctgtccgaa gcgctggagc aaagcccgca ccaggtggtc      1680
     atcaccgacg tgagggccaa cgtgctgtac gtcaaccggg ccttcagcga agtcagcggc      1740
     tacagcgcgc aggaaattct ggggaagaac ccccggatgc tgcagtccgg tctcacgccc      1800
     cgctccgtct acgaggagat gtggcgcagg ctgccccagg gccagccttg gcagggcgaa      1860
     ctcgtcaacc ggcgcaagaa cggccatatc tacaccgaaa tcgtctccct ctacccgatc      1920
     cgtgacctct ccggccaggt gacgcattac gtcgcccaca aggaagacat cactgtgcag      1980
     cgcgaggccg aggagcgcat ccaggccctg tcgaatttcg acacgctgac cggcctgctc      2040
     aacaagaagt ccttcgacga gcggctggcc ctggccatcg agagggccgg agcgagccac      2100
     gggcggcttt ccatgctgtg gttcgacctg gacaacttca agctgatcaa cgagtcgctc      2160
     ggccacacgg ccggagacga gctgctggtg gaggcggcca accgcctgcg ctcctgcctg      2220
     gggacccaga acgcgctggc ccgctattcg ggggacgcct tcgtggccat cgtgccgcag      2280
     gcagaccagg ccagcgtcgc gctcatggcg caggaggccc tgcggcttct gcaaaccgcc      2340
     acatcggtgc agggccatcc cgtgtcggtc agcgcatcgg cgggcgtcgc cgtgtatccc      2400
     gacgatgccc ggacggccgg caccctggcc tcggcggccg agctcgccat gtaccgcgtc      2460
     aaggaggacg ggcgcaacgg cctgcgcttc ttcgcgcccg aaatgcaggc ccacacgcag      2520
     cgctcgctgg agctggcggc gggcctgaag gacgcggcgc gcaagggcga gctgttcctg      2580
     gtctaccagc cccagcgcgc gctgggcagc ggcgcgctgg tcggcgccga ggcgctgctg      2640
     cgctggcgcc acccgcagtg ggggctggtg tcgccggcgg agttcatccc catcgccgag      2700
     caaagcggcg ccatcacggc catcgacttc tgggtggtgg aacaagccgc gcaacagctg      2760
     cgcgcgtggg acgccgccgg ccttccgccg ctggtggtcg cggtgaacgt gtcggcggcg      2820
     cagtttgccc gcccccagct ggccgaggaa ttgctgcaca tcctgcagcg cgtggacgtg      2880
     tcgccgcagc gcatcgaggt ggaactgacg gaggccgtgg cgctcaagca cccggagctg      2940
     gccgagacca ccatccggcg cctgcacgac atgggcttca aggtggcgct ggacgacttc      3000
     ggcaccggct attcgtccat gagctacctc aagcgctaca ccatcgacaa gctcaagatc      3060
     gaccagtcct tcgtgcgcga gctggccgag aagaccagcg acatggccat cgtgacggcc      3120
     atcgtccgca tggcgcacag tctgcacctg tcgaccctcg ccgagggcgt cgagacggcc      3180
     gagcaggccg ccctgctgca cgactgcggc tgcgacgaaa tacagggcta ctggtacagc      3240
     aggcccctgg agcctcgcgc cttcgaagca ttcgccaagg gcctgccgca gcgcggcgcc      3300
     tga                                                                    3303
//

If you have problems or comments...

PBIL Back to PBIL home page